From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004178000
  • symbol?: rsfS
  • description?: iojap family protein

      descriptions from strain specific annotations:

    • iojap family protein
    • Iojap-related protein
    • iojap-like ribosome-associated family protein
    • Iojap protein
    • putative iojap homolog
    • Iojap protein family
  • strand?: -
  • coordinates?: 4442071..4442424
  • synteny block?: BlockID0032080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1550
    08BA02176:
    C248_1634
    11819-97:
    MS7_1609
    71193:
    ST398NM01_1657
    ECT-R 2:
    ECTR2_1441
    ED133:
    SAOV_1591
    ED98:
    SAAV_1583
    HO 5096 0412:
    SAEMRSA15_15110
    JH1:
    SaurJH1_1684
    JH9:
    SaurJH9_1649
    JKD6008:
    SAA6008_01562
    JKD6159:
    SAA6159_01527
    LGA251:
    SARLGA251_14970
    M013:
    M013TW_1606
    MRSA252:
    SAR1669
    MSHR1132:
    SAMSHR1132_14310
    MSSA476:
    SAS1529
    Mu3:
    SAHV_1579
    Mu50:
    SAV1592
    MW2:
    MW1543
    RF122:
    SAB1464c
    ST398:
    SAPIG1657
    T0131:
    SAT0131_01687 (gltX)
    TCH60:
    HMPREF0772_11549
    TW20:
    SATW20_15880
    USA300_TCH1516:
    USA300HOU_1593
    VC40:
    SAVC_07215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVAN
    N315            MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVAN
    NCTC8325        MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVAN
    Newman          MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVAN
    USA300_FPR3757  MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVAN
                    ************************************************************

    COL             EQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYSQVAY
    N315            EQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYGQVAY
    NCTC8325        EQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYSQVAY
    Newman          EQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYSQVAY
    USA300_FPR3757  EQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYSQVAY
                    ****************************************************.****