From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004198000
  • symbol?:
  • description?: divalent metal cation transporter

      descriptions from strain specific annotations:

    • divalent metal cation transporter
    • branched chain amino acid:cation symporter family transporter
    • branched chain amino acid transport system II carrier protein
    • manganese transporter NRAMP
    • membrane protein
    • membrane spanning protein
    • mn2+/fe2+ transporter, nramp family
    • natural resistance-associated macrophage family protein
    • Natural resistance-associated macrophage protein
    • NRAMP family Mn2+/Fe2+ transporter
    • Putative Mn2+/Fe2+ transporter, NRAMP family
    • transmembrane transport protein
  • strand?: -
  • coordinates?: 4453505..4454737
  • synteny block?: BlockID0032270
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1562
    08BA02176:
    C248_1646
    11819-97:
    MS7_1620
    71193:
    ST398NM01_1668
    ECT-R 2:
    ECTR2_1453
    ED133:
    SAOV_1602
    ED98:
    SAAV_1596
    HO 5096 0412:
    SAEMRSA15_15220
    JH1:
    SaurJH1_1695
    JH9:
    SaurJH9_1661
    JKD6008:
    SAA6008_01574 (mntH)
    JKD6159:
    SAA6159_01537 (mntH)
    LGA251:
    SARLGA251_15070
    M013:
    M013TW_1620
    MRSA252:
    SAR1683
    MSHR1132:
    SAMSHR1132_14410
    MSSA476:
    SAS1540
    Mu3:
    SAHV_1591
    Mu50:
    SAV1604
    MW2:
    MW1554
    RF122:
    SAB1475c
    ST398:
    SAPIG1668
    T0131:
    SAT0131_01700 (rplJ)
    TCH60:
    HMPREF0772_11537
    TW20:
    SATW20_15990
    USA300_TCH1516:
    VC40:
    SAVC_07270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGRNLKLKKESDFEFTKNHKRLLLGSVFLMATSAIGPAFLTQTAVFTSQFFASFAFAILL
    N315            MGRNLKLKKESDFEFTKNHKRLLLGSVFLMATSAIGPAFLTQTAVFTSQFFASFAFAILL
    NCTC8325        MGRNLKLKKESDFEFTKNHKRLLLGSVFLMATSAIGPAFLTQTAVFTSQFFASFAFAILL
    Newman          MGRNLKLKKESDFEFTKNHKRLLLGSVFLMATSAIGPAFLTQTAVFTSQFFASFAFAILL
    USA300_FPR3757  MGRNLKLKKESDFEFTKNHKRLLLGSVFLMATSAIGPAFLTQTAVFTSQFFASFAFAILL
                    ************************************************************

    COL             SIIIDIGAQINIWRILVVTGLRGQEISNKVVPGLGTVISILIAFGGLAFNIGNIAGAGLG
    N315            SIIIDIGAQINIWRILVVTGLRGQEISNKVVPGLGTVISILIAFGGLAFNIGNIAGAGLG
    NCTC8325        SIIIDIGAQINIWRILVVTGLRGQEISNKVVPGLGTVISILIAFGGLAFNIGNIAGAGLG
    Newman          SIIIDIGAQINIWRILVVTGLRGQEISNKVVPGLGTVISILIAFGGLAFNIGNIAGAGLG
    USA300_FPR3757  SIIIDIGAQINIWRILVVTGLRGQEISNKVVPGLGTVISILIAFGGLAFNIGNIAGAGLG
                    ************************************************************

    COL             LNAIFGLDVKWGAAITAIFAILIFVSKSGQKIMDVVSMILGIVMILVVAYVMFVSNPPYG
    N315            LNAIFGLDVKWGAAITAIFAILIFVSKSGQKIMDVVSMILGIVMILVVAYVMFVSNPPYG
    NCTC8325        LNAIFGLDVKWGAAITAIFAILIFVSKSGQKIMDVVSMILGIVMILVVAYVMFVSNPPYG
    Newman          LNAIFGLDVKWGAAITAIFAILIFVSKSGQKIMDVVSMILGIVMILVVAYVMFVSNPPYG
    USA300_FPR3757  LNAIFGLDVKWGAAITAIFAILIFVSKSGQKIMDVVSMILGIVMILVVAYVMFVSNPPYG
                    ************************************************************

    COL             DAFVHTFAPEHPMKLVLPIITLVGGTVGGYITFAGAHRILDSGIKGKQYLPFVNQSAIAG
    N315            DAFVHTFAPEHPMKLVLPIITLVGGTVGGYITFAGAHRILDSGIKGKQYLPFVNQSAIAG
    NCTC8325        DAFVHTFAPEHPMKLVLPIITLVGGTVGGYITFAGAHRILDSGIKGKQYLPFVNQSAIAG
    Newman          DAFVHTFAPEHPMKLVLPIITLVGGTVGGYITFAGAHRILDSGIKGKQYLPFVNQSAIAG
    USA300_FPR3757  DAFVHTFAPEHPMKLVLPIITLVGGTVGGYITFAGAHRILDSGIKGKQYLPFVNQSAIAG
                    ************************************************************

    COL             ILTTGIMRTLLFLAVLGVVVTGVTLSSENPPASVFEHAIGPIGKNIFGIVLFAAAMSSVI
    N315            ILTTGIMRTLLFLAVLGVVVTGVTLSSENPPASVFEHAIGPIGKNIFGIVLFAAAMSSVI
    NCTC8325        ILTTGIMRTLLFLAVLGVVVTGVTLSSENPPASVFEHAIGPIGKNIFGIVLFAAAMSSVI
    Newman          ILTTGIMRTLLFLAVLGVVVTGVTLSSENPPASVFEHAIGPIGKNIFGIVLFAAAMSSVI
    USA300_FPR3757  ILTTGIMRTLLFLAVLGVVVTGVTLSSENPPASVFEHAIGPIGKNIFGIVLFAAAMSSVI
                    ************************************************************

    COL             GSAYTSATFLKTLHKSLNERSNLIVIVFIVISTMIFLFIGKPISLLIIAGAINGWILPIT
    N315            GSAYTSATFLKTLHKSLNERSNLIVIVFIVISTMIFLFIGKPISLLIIAGAINGWILPIT
    NCTC8325        GSAYTSATFLKTLHKSLNERSNLIVIVFIVISTMIFLFIGKPISLLIIAGAINGWILPIT
    Newman          GSAYTSATFLKTLHKSLNERSNLIVIVFIVISTMIFLFIGKPISLLIIAGAINGWILPIT
    USA300_FPR3757  GSAYTSATFLKTLHKSLNERSNLIVIVFIVISTMIFLFIGKPISLLIIAGAINGWILPIT
                    ************************************************************

    COL             LGAILIASKKKSIVGDYKHPNWMFIFGIVAVLVTILTGIFSFKEVLQLF
    N315            LGAILIASKKKSIVGDYKHPNWMFIFGIVAVLVTILTGIFSFKEVLQLF
    NCTC8325        LGAILIASKKKSIVGDYKHPNWMFIFGIVAVLVTILTGIFSFKEVLQLF
    Newman          LGAILIASKKKSIVGDYKHPNWMFIFGIVAVLVTILTGIFSFKEVLQLF
    USA300_FPR3757  LGAILIASKKKSIVGDYKHPNWMFIFGIVAVLVTILTGIFSFKEVLQLF
                    *************************************************