From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004200000
  • symbol?:
  • description?: acetyl-CoA carboxylase

      descriptions from strain specific annotations:

    • acetyl-CoA carboxylase
    • carbamoyl-phosphate synthase subunit L
    • carbamoyl-phosphate synthase L chain ATP-binding
    • putative biotin carboxylase subunit of acetyl-CoA carboxylase
    • acetyl-CoA carboxylase, biotin carboxylase
    • acetyl-CoA biotin carboxylase
    • acetyl-CoA carboxylase biotin carboxylase subunit, AccC_1
    • Carbamoyl-phosphate synthase L chain, ATP-binding protein
    • acetyl-CoA carboxylase, biotin carboxylase, putative
    • carbamoyl-phosphate synthase L chain, N-terminal domain protein
    • biotin carboxylase (Acetyl-CoA carboxylase subunit A) (ACC)
  • strand?: -
  • coordinates?: 4455502..4456227
  • synteny block?: BlockID0032290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1507 (accC)
    USA300_FPR3757:
    04-02981:
    SA2981_1564 (accC)
    08BA02176:
    C248_1648
    11819-97:
    MS7_1622
    71193:
    ST398NM01_1670
    ECT-R 2:
    ECTR2_1455
    ED133:
    SAOV_1604 (accC_1)
    ED98:
    SAAV_1598
    HO 5096 0412:
    SAEMRSA15_15240
    JH1:
    SaurJH1_1697
    JH9:
    SaurJH9_1663
    JKD6008:
    SAA6008_01576 (accC_1)
    JKD6159:
    SAA6159_01539 (accC_1)
    LGA251:
    SARLGA251_15090
    M013:
    M013TW_1622
    MRSA252:
    SAR1685
    MSHR1132:
    SAMSHR1132_14430
    MSSA476:
    SAS1542
    Mu3:
    SAHV_1593
    Mu50:
    SAV1606
    MW2:
    MW1556
    RF122:
    SAB1477c (accC)
    ST398:
    SAPIG1670
    T0131:
    SAT0131_01702
    TCH60:
    HMPREF0772_11535 (accC)
    TW20:
    SATW20_16010
    USA300_TCH1516:
    USA300HOU_1606
    VC40:
    SAVC_07280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLRCLIANRGEIAVRIIRACREYGIETVAVYAKGDEQSLHVHLADQAICIGEANALDSYL
    N315            MLRCLIANRGEIAVRIIRACREYGIETVAVYAKGDEQSLHVHLADQAICIGEANALDSYL
    NCTC8325        MLRCLIANRGEIAVRIIRACREYGIETVAVYAKGDEQSLHVHLADQAICIGEANALDSYL
    Newman          MLRCLIANRGEIAVRIIRACREYGIETVAVYAKGDEQSLHVHLADQAICIGEANALDSYL
    USA300_FPR3757  MLRCLIANRGEIAVRIIRACREYGIETVAVYAKGDEQSLHVHLADQAICIGEANALDSYL
                    ************************************************************

    COL             NIDRIISAAQITGANAIHPGYGFLSESTKFAQTVEEQGIAFIGPTKKTMEMMGDKITARQ
    N315            NIDRIISAAQITGANAIHPGYGFLSESTKFAQTVEEQGIAFIGPTKKTMEMMGDKITARQ
    NCTC8325        NIDRIISAAQITGANAIHPGYGFLSESTKFAQTVEEQGIAFIGPTKKTMEMMGDKITARQ
    Newman          NIDRIISAAQITGANAIHPGYGFLSESTKFAQTVEEQGIAFIGPTKKTMEMMGDKITARQ
    USA300_FPR3757  NIDRIISAAQITGANAIHPGYGFLSESTKFAQTVEEQGIAFIGPTKKTMEMMGDKITARQ
                    ************************************************************

    COL             TVHHAGVPVIPGSNGAVNHVSEIENLAKDIGYPVVIKAASGGGGKGIRIVKKAEDLEKAF
    N315            TVHHAGVPVIPGSNGAVNHVSEIENLAKDIGYPVVIKAASGGGGKGIRIVKKAEDLEKAF
    NCTC8325        TVHHAGVPVIPGSNGAVNHVSEIENLAKDIGYPVVIKAASGGGGKGIRIVKKAEDLEKAF
    Newman          TVHHAGVPVIPGSNGAVNHVSEIENLAKDIGYPVVIKAASGGGGKGIRIVKKAEDLEKAF
    USA300_FPR3757  TVHHAGVPVIPGSNGAVNHVSEIENLAKDIGYPVVIKAASGGGGKGIRIVKKAEDLEKAF
                    ************************************************************

    COL             KEAKSEGKKYFDDDRVYVEAFIPVAKHVEVQVMGDGQDNYVHLGERDCSVQRKNQKLIEE
    N315            KEAKSEGKKYFDDDRVYVEAFIPVAKHVEVQVMGDGQDNYVHLGERDCSVQRKNQKLIEE
    NCTC8325        KEAKSEGKKYFDDDRVYVEAFIPVAKHVEVQVMGDGQDNYVHLGERDCSVQRKNQKLIEE
    Newman          KEAKSEGKKYFDDDRVYVEAFIPVAKHVEVQVMGDGQDNYVHLGERDCSVQRKNQKLIEE
    USA300_FPR3757  KEAKSEGKKYFDDDRVYVEAFIPVAKHVEVQVMGDGQDNYVHLGERDCSVQRKNQKLIEE
                    ************************************************************

    COL             SPCAALTEERRQQICNDAVKVARAANYRSAGTIEFLVTDTAHYFIEMNARIQVEHTVTEM
    N315            SPCAALTEERRQQICNDAVKVARAANYRSAGTIEFLVTDTAHYFIEMNARIQVEHTVTEM
    NCTC8325        SPCAALTEERRQQICNDAVKVARAANYRSAGTIEFLVTDTAHYFIEMNARIQVEHTVTEM
    Newman          SPCAALTEERRQQICNDAVKVARAANYRSAGTIEFLVTDTAHYFIEMNARIQVEHTVTEM
    USA300_FPR3757  SPCAALTEERRQQICNDAVKVARAANYRSAGTIEFLVTDTAHYFIEMNARIQVEHTVTEM
                    ************************************************************

    COL             RAERDLVAAQLYLLEHNHLPFSQSDIQFNGHVIEARINAENPEKKFQPTPGKVTALHLPQ
    N315            RAERDLVAAQLYLLEHNHLPFSQSDIQFNGHVIEARINAENPEKKFQPTPGKVTALHLPQ
    NCTC8325        RAERDLVAAQLYLLEHNHLPFSQSDIQFNGHVIEARINAENPEKKFQPTPGKVTALHLPQ
    Newman          RAERDLVAAQLYLLEHNHLPFSQSDIQFNGHVIEARINAENPEKKFQPTPGKVTALHLPQ
    USA300_FPR3757  RAERDLVAAQLYLLEHNHLPFSQSDIQFNGHVIEARINAENPEKKFQPTPGKVTALHLPQ
                    ************************************************************

    COL             GFNVRVDSLLYHGYQVSPYYDSLVAKVIVKSHDRASAIDKLKVTLDEMVIDGFSTTADFL
    N315            GFNVRVDSLLYHGYQVSPYYDSLVAKVIVKSHDRASAIDKLKVTLDEMVIDGFSTTADFL
    NCTC8325        GFNVRVDSLLYHGYQVSPYYDSLVAKVIVKSHDRASAIDKLKVTLDEMVIDGFSTTADFL
    Newman          GFNVRVDSLLYHGYQVSPYYDSLVAKVIVKSHDRASAIDKLKVTLDEMVIDGFSTTADFL
    USA300_FPR3757  GFNVRVDSLLYHGYQVSPYYDSLVAKVIVKSHDRASAIDKLKVTLDEMVIDGFSTTADFL
                    ************************************************************

    COL             YAVLNYPLYRDGDAKDVDIKFLEKHQIVKGVEL
    N315            YAVLNYPLYRDGDAKDVDIKFLEKHQIVKGVEL
    NCTC8325        YAVLNYPLYRDGDAKDVDIKFLEKHQIVKGVEL
    Newman          YAVLNYPLYRDGDAKDVDIKFLEKHQIVKGVEL
    USA300_FPR3757  YAVLNYPLYRDGDAKDVDIKFLEKHQIVKGVEL
                    *********************************