From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004205000
  • symbol?:
  • description?: allophanate hydrolase subunit 1

      descriptions from strain specific annotations:

    • allophanate hydrolase subunit 1
    • allophanate hydrolase subunit 1 family protein
    • allophanate hydrolase 2 subunit 1
    • Kinase autophosphorylation inhibitor
  • strand?: -
  • coordinates?: 4458338..4459039
  • synteny block?: BlockID0032330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1567
    08BA02176:
    C248_1651
    11819-97:
    MS7_1625
    71193:
    ST398NM01_1673
    ECT-R 2:
    ECTR2_1458
    ED133:
    SAOV_1607
    ED98:
    SAAV_1601
    HO 5096 0412:
    SAEMRSA15_15270
    JH1:
    SaurJH1_1700
    JH9:
    SaurJH9_1666
    JKD6008:
    SAA6008_01579
    JKD6159:
    SAA6159_01542
    LGA251:
    SARLGA251_15120
    M013:
    M013TW_1628
    MRSA252:
    SAR1688
    MSHR1132:
    SAMSHR1132_14460
    MSSA476:
    SAS1545
    Mu3:
    SAHV_1596
    Mu50:
    SAV1609
    MW2:
    MW1559
    RF122:
    SAB1480c
    ST398:
    SAPIG1673
    T0131:
    SAT0131_01705
    TCH60:
    HMPREF0772_11532 (dur1)
    TW20:
    SATW20_16040
    USA300_TCH1516:
    USA300HOU_1609
    VC40:
    SAVC_07295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDVRFINEQTIMIYFENKISEETYRNVTAMVRWIREKEILEIQDIVPSYRAVLIYFDEQA
    N315            MDVRFINEQTIMIYFENKISEETYRNVTAMVRWIREKEILEIQDIVPSYRAVLIYFDEQA
    NCTC8325        -----------MIYFENKISEETYRNVTAMVRWIREKEILEIQDIVPSYRAVLIYFDEQA
    Newman          MDVRFINEQTIMIYFENKISEETYRNVTAMVRWIREKEILEIQDIVPSYRAVLIYFDEQA
    USA300_FPR3757  -----------MIYFENKISEETYRNVTAMVRWIREKEILEIQDIVPSYRAVLIYFDEQA
                               *************************************************

    COL             ITSSKLIENLELNKFNEKNVHAVNQTNRIIKIPVQYGGTYGPDIEEVAKHNRITVEQVIE
    N315            ITSSKLIENLELNKFNEKNVHAVNQTNRIIKIPVQYGGTYGPDIEEVAKHNRITVEQVIE
    NCTC8325        ITSSKLIENLELNKFNEKNVHAVNQTNRIIKIPVQYGGTYGPDIEEVAKHNRITVEQVIE
    Newman          ITSSKLIENLELNKFNEKNVHAVNQTNRIIKIPVQYGGTYGPDIEEVAKHNRITVEQVIE
    USA300_FPR3757  ITSSKLIENLELNKFNEKNVHAVNQTNRIIKIPVQYGGTYGPDIEEVAKHNRITVEQVIE
                    ************************************************************

    COL             KHTSKPYLIYMLGFMPGFPYLGGLDEQLHTPRRNQPRLKIHAGSVGIANNQTGLYPSDSP
    N315            KHTSKPYLIYMLGFMPGFPYLGGLDEQLHTPRRNQPRLKIHAGSVGIANNQTGLYPSDSP
    NCTC8325        KHTSKPYLIYMLGFMPGFPYLGGLDEQLHTPRRNQPRLKIHAGSVGIANNQTGLYPSDSP
    Newman          KHTSKPYLIYMLGFMPGFPYLGGLDEQLHTPRRNQPRLKIHAGSVGIANNQTGLYPSDSP
    USA300_FPR3757  KHTSKPYLIYMLGFMPGFPYLGGLDEQLHTPRRNQPRLKIHAGSVGIANNQTGLYPSDSP
                    ************************************************************

    COL             GGWQIIGRTPLKVFSSEREPMSMYEAGEWIQFYAIDEQKFIQIERDISDGNFNVDDWVVI
    N315            GGWQIIGRTPLKVFSSEREPMSMYEAGEWIQFYAIDEQKFIQIERDISDGNFNVDDWVVI
    NCTC8325        GGWQIIGRTPLKVFSSEREPMSMYEAGEWIQFYAIDEQKFIQIERDISDGNFNVDDWVVI
    Newman          GGWQIIGRTPLKVFSSEREPMSMYEAGEWIQFYAIDEQKFIQIERDISDGNFNVDDWVVI
    USA300_FPR3757  GGWQIIGRTPLKVFSSEREPMSMYEAGEWIQFYAIDEQKFIQIERDISDGNFNVDDWVVI
                    ************************************************************

    COL             ENVN
    N315            ENVN
    NCTC8325        ENVN
    Newman          ENVN
    USA300_FPR3757  ENVN
                    ****