From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004208000
  • symbol?:
  • description?: collagenase-like protease

      descriptions from strain specific annotations:

    • collagenase-like protease
    • U32 family peptidase
    • peptidase U32 family protein
    • peptidase U32
    • peptidase, U32 family large subunit (C1)
    • peptidase family U32 family protein
    • protease
    • proteinase
    • putative peptidase
  • strand?: -
  • coordinates?: 4460536..4461804
  • synteny block?: BlockID0032360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1570
    08BA02176:
    C248_1654
    11819-97:
    MS7_1628
    71193:
    ST398NM01_1676
    ECT-R 2:
    ECTR2_1461
    ED133:
    SAOV_1610
    ED98:
    SAAV_1604
    HO 5096 0412:
    SAEMRSA15_15300
    JH1:
    SaurJH1_1703
    JH9:
    SaurJH9_1669
    JKD6008:
    SAA6008_01582
    JKD6159:
    SAA6159_01545
    LGA251:
    SARLGA251_15150
    M013:
    M013TW_1631
    MRSA252:
    SAR1691
    MSHR1132:
    SAMSHR1132_14490
    MSSA476:
    SAS1548
    Mu3:
    SAHV_1599
    Mu50:
    SAV1612
    MW2:
    MW1562
    RF122:
    SAB1483c
    ST398:
    SAPIG1676
    T0131:
    SAT0131_01709 (fus)
    TCH60:
    HMPREF0772_11529
    TW20:
    SATW20_16070
    USA300_TCH1516:
    USA300HOU_1612
    VC40:
    SAVC_07310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTIEEIKSTPKTVMKKPELLAPAGNLEKLKIAVHYGADAVFLGGQEYGLRSNADNFTME
    N315            MKTIEEIKSTPKTVMKKPELLAPAGNLEKLKIAVHYGADAVFLGGQEYGLRSNADNFTME
    NCTC8325        MKTIEEIKSTPKTVMKKPELLAPAGNLEKLKIAVHYGADAVFLGGQEYGLRSNADNFTME
    Newman          MKTIEEIKSTPKTVMKKPELLAPAGNLEKLKIAVHYGADAVFLGGQEYGLRSNADNFTME
    USA300_FPR3757  MKTIEEIKSTPKTVMKKPELLAPAGNLEKLKIAVHYGADAVFLGGQEYGLRSNADNFTME
                    ************************************************************

    COL             EIAEGVEFANRYGAKIYVTTNIIAHDENIEGLESYLRNLEKTGATGIIVADPLIIETCKE
    N315            EIAEGVEFANRYGAKIYVTTNIIAHDENIEGLESYLRNLEKTGATGIIVADPLIIETCKE
    NCTC8325        EIAEGVEFANRYGAKIYVTTNIIAHDENIEGLESYLRNLEKTGATGIIVADPLIIETCKE
    Newman          EIAEGVEFANRYGAKIYVTTNIIAHDENIEGLESYLRNLEKTGATGIIVADPLIIETCKE
    USA300_FPR3757  EIAEGVEFANRYGAKIYVTTNIIAHDENIEGLESYLRNLEKTGATGIIVADPLIIETCKE
                    ************************************************************

    COL             VAPKLEIHLSTQQSLSNYKAVEYWKEEGLDRVVLARETGAMEMREMKEKVDIEIEAFIHG
    N315            VAPKLEIHLSTQQSLSNYKAVEYWKEEGLDRVVLARETGAMEMREMKEKVDIEIEAFIHG
    NCTC8325        VAPKLEIHLSTQQSLSNYKAVEYWKEEGLDRVVLARETGAMEMREMKEKVDIEIEAFIHG
    Newman          VAPKLEIHLSTQQSLSNYKAVEYWKEEGLDRVVLARETGAMEMREMKEKVDIEIEAFIHG
    USA300_FPR3757  VAPKLEIHLSTQQSLSNYKAVEYWKEEGLDRVVLARETGAMEMREMKEKVDIEIEAFIHG
                    ************************************************************

    COL             AMCIAYSGRCTLSNHMTARDSNRGGCCQSCRWDYELLEVDDNGELDVFYNQGEVTPFAMS
    N315            AMCIAYSGRCTLSNHMTARDSNRGGCCQSCRWDYELLEVDDNGELDVFYNQGEVTPFAMS
    NCTC8325        AMCIAYSGRCTLSNHMTARDSNRGGCCQSCRWDYELLEVDDNGELDVFYNQGEVTPFAMS
    Newman          AMCIAYSGRCTLSNHMTARDSNRGGCCQSCRWDYELLEVDDNGELDVFYNQGEVTPFAMS
    USA300_FPR3757  AMCIAYSGRCTLSNHMTARDSNRGGCCQSCRWDYELLEVDDNGELDVFYNQGEVTPFAMS
                    ************************************************************

    COL             PKDLKLIESIPQMMDIGVDSLKIEGRMKSIHYIATVVSVYRKVIDAYAADPDNFKINPEW
    N315            PKDLKLIESIPQMMDIGVDSLKIEGRMKSIHYIATVVSVYRKVIDAYAADPDNFKINPEW
    NCTC8325        PKDLKLIESIPQMMDIGVDSLKIEGRMKSIHYIATVVSVYRKVIDAYAADPDNFKINPEW
    Newman          PKDLKLIESIPQMMDIGVDSLKIEGRMKSIHYIATVVSVYRKVIDAYAADPDNFKINPEW
    USA300_FPR3757  PKDLKLIESIPQMMDIGVDSLKIEGRMKSIHYIATVVSVYRKVIDAYAADPDNFKINPEW
                    ************************************************************

    COL             LIELDKCANRDTAPAFFEGTPGYEEQMFGQQQSKKSSFDFCGLVLDYNEDTKIATIQQRN
    N315            LIELDKCANRDTAPAFFEGTPGYEEQMFGQQQSKKSPFDFCGLVLDYNEDTKIATIQQRN
    NCTC8325        LIELDKCANRDTAPAFFEGTPGYEEQMFGQQQSKKSPFDFCGLVLDYNEDTKIATIQQRN
    Newman          LIELDKCANRDTAPAFFEGTPGYEEQMFGQQQSKKSPFDFCGLVLDYNEDTKIATIQQRN
    USA300_FPR3757  LIELDKCANRDTAPAFFEGTPGYEEQMFGQQQSKKSPFDFCGLVLDYNEDTKIATIQQRN
                    ************************************.***********************

    COL             NFKPGQEIEFFGPEIETFTQVVEAIYDEEGNSLDAARHPLQIVQIKVDRPIYPNNMMRKE
    N315            NFKPGQEIEFFGPEIETFTQVVEAIYDEEGNSLDAARHPLQIVQIKVDRPIYPNNMMRKE
    NCTC8325        NFKPGQEIEFFGPEIETFTQVVEAIYDEEGNSLDAARHPLQIVQIKVDRPIYPNNMMRKE
    Newman          NFKPGQEIEFFGPEIETFTQVVEAIYDEEGNSLDAARHPLQIVQIKVDRPIYPNNMMRKE
    USA300_FPR3757  NFKPGQEIEFFGPEIETFTQVVEAIYDEEGNSLDAARHPLQIVQIKVDRPIYPNNMMRKE
                    ************************************************************

    COL             IG
    N315            IG
    NCTC8325        IG
    Newman          IG
    USA300_FPR3757  IG
                    **