From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004223000
  • symbol?: iscS
  • description?: cysteine desulfurase

      descriptions from strain specific annotations:

    • cysteine desulfurase
    • aminotransferase, class V
    • class V aminotransferase
    • aminotransferase class-V family protein
    • cysteine desulfurase, NifS
    • iron-sulfur cofactor synthesis protein
    • putative cysteine desulfurase
    • Selenocysteine lyase
  • strand?: -
  • coordinates?: 4472984..4474126
  • synteny block?: BlockID0032510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1580
    08BA02176:
    C248_1664
    11819-97:
    MS7_1638
    71193:
    ST398NM01_1686
    ECT-R 2:
    ECTR2_1471
    ED133:
    SAOV_1620
    ED98:
    SAAV_1615
    HO 5096 0412:
    SAEMRSA15_15400
    JH1:
    SaurJH1_1713
    JH9:
    SaurJH9_1680
    JKD6008:
    SAA6008_01592 (nifS)
    JKD6159:
    SAA6159_01555 (nifS)
    LGA251:
    SARLGA251_15250
    M013:
    M013TW_1643
    MRSA252:
    SAR1702
    MSHR1132:
    SAMSHR1132_14590
    MSSA476:
    SAS1558
    Mu3:
    SAHV_1609
    Mu50:
    SAV1622
    MW2:
    MW1572
    RF122:
    SAB1493c
    ST398:
    SAPIG1686
    T0131:
    SAT0131_01719
    TCH60:
    HMPREF0772_11519 (iscS2)
    TW20:
    SATW20_16170
    USA300_TCH1516:
    USA300HOU_1622 (csd1)
    VC40:
    SAVC_07360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEIYADYAATTPVKPEVVDAMMTIYNSHYGNPSSIHAKGRDARKYLDESRRQIAQLLGAD
    N315            MEIYADYAATTPVKPEVVDAMMMIYNSHYGNPSSIHAKGRDARKYLDESRRQIAQLLGAD
    NCTC8325        MEIYADYAATTPVKPEVVDAMMTIYNSHYGNPSSIHAKGRDARKYLDESRRQIAQLLGAD
    Newman          MEIYADYAATTPVKPEVVDAMMTIYNSHYGNPSSIHAKGRDARKYLDESRRQIAQLLGAD
    USA300_FPR3757  MEIYADYAATTPVKPEVVDAMMTIYNSHYGNPSSIHAKGRDARKYLDESRRQIAQLLGAD
                    ********************** *************************************

    COL             THEIIFTSGATESNNTAIKGIVKANEQLGNHIITSKIEHHSVLHVFEQLEREGFDVTYLD
    N315            THEIIFTSGATESNNTAIKGIVKANEQLGNHIITSKIEHHSVLHVFEQLEREGFDVTYLD
    NCTC8325        THEIIFTSGATESNNTAIKGIVKANEQLGNHIITSKIEHHSVLHVFEQLEREGFDVTYLD
    Newman          THEIIFTSGATESNNTAIKGIVKANEQLGNHIITSKIEHHSVLHVFEQLEREGFDVTYLD
    USA300_FPR3757  THEIIFTSGATESNNTAIKGIVKANEQLGNHIITSKIEHHSVLHVFEQLEREGFDVTYLD
                    ************************************************************

    COL             VDDTGAIDLDQLEETITDKTILVSIMFVNNEVGTVQQIYDIQDIIAETNAYFHVDAVQAI
    N315            VDDTGAIDLDQLEETITDKTILVSIMFVNNEVGTVQQIYDIQDIIAETNAYFHVDAVQAI
    NCTC8325        VDDTGAIDLDQLEETITDKTILVSIMFVNNEVGTVQQIYDIQDIIAETNAYFHVDAVQAI
    Newman          VDDTGAIDLDQLEETITDKTILVSIMFVNNEVGTVQQIYDIQDIIAETNAYFHVDAVQAI
    USA300_FPR3757  VDDTGAIDLDQLEETITDKTILVSIMFVNNEVGTVQQIYDIQDIIAETNAYFHVDAVQAI
                    ************************************************************

    COL             GHLDVKFDEFEIDAMSITAHKFGGPKGVGALLVKDHVTLDYPQLGGEQELKRRAGTENLA
    N315            GHLDVKFDEFEIDAMSITAHKFGGPKGVGALLVKDHVTLDYPQLGGEQELKRRAGTENLA
    NCTC8325        GHLDVKFDEFEIDAMSITAHKFGGPKGVGALLVKDHVTLDYPQLGGEQELKRRAGTENLA
    Newman          GHLDVKFDEFEIDAMSITAHKFGGPKGVGALLVKDHVTLDYPQLGGEQELKRRAGTENLA
    USA300_FPR3757  GHLDVKFDEFEIDAMSITAHKFGGPKGVGALLVKDHVTLDYPQLGGEQELKRRAGTENLA
                    ************************************************************

    COL             QIVGMAKALQLAEKNRDDNNIHLMNLKEQFLVKLQERAIPFELNGSMTDATGHIVNLYFP
    N315            QIVGMAKALQLAEKNRDDNNIHLMNLKEQFLVKLQERAIPFELNGSMTDATGHIVNLYFP
    NCTC8325        QIVGMAKALQLAEKNRDDNNIHLMNLKEQFLVKLQERAIPFELNGSMTDATGHIVNLYFP
    Newman          QIVGMAKALQLAEKNRDDNNIHLMNLKEQFLVKLQERAIPFELNGSMTDATGHIVNLYFP
    USA300_FPR3757  QIVGMAKALQLAEKNRDDNNIHLMNLKEQFLVKLQERAIPFELNGSMTDATGHIVNLYFP
                    ************************************************************

    COL             FVEVETMLTLLDMAQIYVSSGSACTAGSTQPSHVLDAMFEDEERSNHSIRFSFNELTTEN
    N315            FVEVEMMLTLLDMAQIYVSSGSACTAGSTQPSHVLDAMFEDEERSNHSIRFSFNELTTEN
    NCTC8325        FVEVETMLTLLDMAQIYVSSGSACTAGSTQPSHVLDAMFEDEERSNHSIRFSFNELTTEN
    Newman          FVEVETMLTLLDMAQIYVSSGSACTAGSTQPSHVLDAMFEDEERSNHSIRFSFNELTTEN
    USA300_FPR3757  FVEVETMLTLLDMAQIYVSSGSACTAGSTQPSHVLDAMFEDEERSNHSIRFSFNELTTEN
                    ***** ******************************************************

    COL             EINAIVAEIHKIYFKFKEES
    N315            EINAIVAEIHKIYFKFKEES
    NCTC8325        EINAIVAEIHKIYFKFKEES
    Newman          EINAIVAEIHKIYFKFKEES
    USA300_FPR3757  EINAIVAEIHKIYFKFKEES
                    ********************