From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004230000
  • symbol?:
  • description?: recombination factor protein RarA

      descriptions from strain specific annotations:

    • recombination factor protein RarA
    • ATPase related to helicase subunit of the Holliday junction resolvase
    • ATPase family associated with various cellular activities (AAA) family protein
    • putative ATPase
    • DNA-directed DNA polymerase III subunit gamma and tau
    • AAA ATPase
    • putative ATPase (AAA family)
    • ATPase, AAA family
  • strand?: +
  • coordinates?: 4476688..4477971
  • synteny block?: BlockID0032580
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1585
    08BA02176:
    C248_1669
    11819-97:
    MS7_1643
    71193:
    ST398NM01_1691
    ECT-R 2:
    ECTR2_1476
    ED133:
    SAOV_1625
    ED98:
    SAAV_1620
    HO 5096 0412:
    SAEMRSA15_15450
    JH1:
    SaurJH1_1718
    JH9:
    SaurJH9_1685
    JKD6008:
    SAA6008_01597 (rarA)
    JKD6159:
    SAA6159_01560 (rarA)
    LGA251:
    SARLGA251_15300
    M013:
    M013TW_1648
    MRSA252:
    SAR1707
    MSHR1132:
    SAMSHR1132_14640
    MSSA476:
    SAS1563
    Mu3:
    SAHV_1614
    Mu50:
    SAV1627
    MW2:
    MW1577
    RF122:
    SAB1497
    ST398:
    SAPIG1691
    T0131:
    SAT0131_01725
    TCH60:
    HMPREF0772_11514
    TW20:
    SATW20_16220
    USA300_TCH1516:
    VC40:
    SAVC_07385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSTEPLASRMRPKNIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
    N315            MSTEPLASRMRPKNIDEIISQQHLVGPKGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
    NCTC8325        MSTEPLASRMRPKNIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
    Newman          MSTEPLASRMRPKNIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
    USA300_FPR3757  MSTEPLASRMRPKNIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
                    ***************************:********************************

    COL             SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
    N315            SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
    NCTC8325        SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
    Newman          SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
    USA300_FPR3757  SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
                    ************************************************************

    COL             IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
    N315            IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
    NCTC8325        IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
    Newman          IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
    USA300_FPR3757  IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
                    ************************************************************

    COL             DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
    N315            DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
    NCTC8325        DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
    Newman          DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
    USA300_FPR3757  DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
                    ************************************************************

    COL             HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
    N315            HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
    NCTC8325        HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
    Newman          HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
    USA300_FPR3757  HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
                    ************************************************************

    COL             AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
    N315            AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
    NCTC8325        AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
    Newman          AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
    USA300_FPR3757  AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
                    ************************************************************

    COL             HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
    N315            HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
    NCTC8325        HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
    Newman          HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
    USA300_FPR3757  HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
                    ************************************************************

    COL             KQRP
    N315            KQRP
    NCTC8325        KQRP
    Newman          KQRP
    USA300_FPR3757  KQRP
                    ****