From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004241000
  • symbol?: recJ
  • description?: single-stranded-DNA-specific exonuclease RecJ

      descriptions from strain specific annotations:

    • single-stranded-DNA-specific exonuclease RecJ
    • putative single-stranded-DNA-specificexonuclease
    • protein RecJ
    • recombination protein RecJ
    • single-strand DNA-specific exonuclease
    • ssDNA-binding protein
    • ssDNA-specific exonuclease RecJ
  • strand?: -
  • coordinates?: 4487425..4489506
  • synteny block?: BlockID0032690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1691 (recJ)
    N315:
    NCTC8325:
    Newman:
    NWMN_1538 (recJ)
    USA300_FPR3757:
    04-02981:
    SA2981_1594 (recJ)
    08BA02176:
    C248_1679
    11819-97:
    MS7_1651 (recJ)
    71193:
    ST398NM01_1699
    ECT-R 2:
    ECTR2_1484 (recJ)
    ED133:
    SAOV_1633
    ED98:
    SAAV_1629 (recJ)
    HO 5096 0412:
    SAEMRSA15_15530
    JH1:
    SaurJH1_1726
    JH9:
    SaurJH9_1693
    JKD6008:
    SAA6008_01605 (recJ)
    JKD6159:
    SAA6159_01568 (recJ)
    LGA251:
    SARLGA251_15380
    M013:
    M013TW_1656
    MRSA252:
    SAR1716
    MSHR1132:
    SAMSHR1132_14720
    MSSA476:
    SAS1572
    Mu3:
    SAHV_1623
    Mu50:
    SAV1636
    MW2:
    MW1586
    RF122:
    SAB1505c
    ST398:
    SAPIG1699 (recJ)
    T0131:
    SAT0131_01735
    TCH60:
    HMPREF0772_11506 (recJ)
    TW20:
    SATW20_16300
    USA300_TCH1516:
    USA300HOU_1634 (recJ)
    VC40:
    SAVC_07425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKPKYKWKLTKPAEYISDELTSKLKLTPIVKKILESKSIIDEQAIESIISDTDINHDAL
    N315            MIKPKYKWKLTKPAEYISDELTSKLKLTPIVKKILESKSIIDEQAIESIISDTDVNHDAL
    NCTC8325        MIKPKYKWKLTKPAEYISDELTSKLKLTPIVKKILESKSIIDEQAIESIISDTDINHDAL
    Newman          MIKPKYKWKLTKPAEYISDELTSKLKLTPIVKKILESKSIIDEQAIESIISDTDINHDAL
    USA300_FPR3757  MIKPKYKWKLTKPAEYISDELTSKLKLTPIVKKILESKSIIDEQAIESIISDTDINHDAL
                    ******************************************************:*****

    COL             QLSDMTKTIERIKRAIANDEKILVYGDYDADGVTATTILVITLQLLGAQVGWHIPNRFTE
    N315            QLSDMTKAIERIKRAIANDEKILVYGDYDADGVTSTTILVTTLQLLGAQVGWHIPNRFTE
    NCTC8325        QLSDMTKTIERIKRAIANDEKILVYGDYDADGVTATTILVITLQLLGAQVGWHIPNRFTE
    Newman          QLSDMTKTIERIKRAIANDEKILVYGDYDADGVTATTILVITLQLLGAQVGWHIPNRFTE
    USA300_FPR3757  QLSDMTKTIERIKRAIANDEKILVYGDYDADGVTATTILVITLQLLGAQVGWHIPNRFTE
                    *******:**************************:***** *******************

    COL             GYGPNELAFRNAHDEGITLIITVDNGIQGHNEIKMVQDLGVDVIVTDHHEIGSTLPEAYA
    N315            GYGPNELAFRNAHDEGITLIITVDNGIQGHNEIKMVQDLGVDVIVTDHHEIGSTLPEAYA
    NCTC8325        GYGPNELAFRNAHDEGITLIITVDNGIQGHNEIKMVQDLGVDVIVTDHHEIGSTLPEAYA
    Newman          GYGPNELAFRNAHDEGITLIITVDNGIQGHNEIKMVQDLGVDVIVTDHHEIGSTLPEAYA
    USA300_FPR3757  GYGPNELAFRNAHDEGITLIITVDNGIQGHNEIKMVQDLGVDVIVTDHHEIGSTLPEAYA
                    ************************************************************

    COL             IVHPMHPSFNYPFQQLCGAGVAYKLAQALIENVPDYFKALVAIGTIADLVSLTDENRSLV
    N315            IVHPMHPSFNYPFQQLCGAGVAYKLAQALIENVPDYFKALVAIGTIADLVSLTDENRSLV
    NCTC8325        IVHPMHPSFNYPFQQLCGAGVAYKLAQALIENVPDYFKALVAIGTIADLVSLTDENRSLV
    Newman          IVHPMHPSFNYPFQQLCGAGVAYKLAQALIENVPDYFKALVAIGTIADLVSLTDENRSLV
    USA300_FPR3757  IVHPMHPSFNYPFQQLCGAGVAYKLAQALIENVPDYFKALVAIGTIADLVSLTDENRSLV
                    ************************************************************

    COL             KQGLKVLNDQCPTSVKALLKEAGYNDNIDEETIGFIIGPRLNAVGRLDDASLACELLMTD
    N315            KQGLKVLNDQCPTSVKALLKEAGYNDNIDEETIGFIIGPRLNAVGRLDDASLACELLMTD
    NCTC8325        KQGLKVLNDQCPTSVKALLKEAGYNDNIDEETIGFIIGPRLNAVGRLDDASLACELLMTD
    Newman          KQGLKVLNDQCPTSVKALLKEAGYNDNIDEETIGFIIGPRLNAVGRLDDASLACELLMTD
    USA300_FPR3757  KQGLKVLNDQCPTSVKALLKEAGYNDNIDEETIGFIIGPRLNAVGRLDDASLACELLMTD
                    ************************************************************

    COL             VEEEAAFLAEQVEHFNRERKDIVATITEEAMAMAETKVKKGDLFLLLAKENWHEGVLGIV
    N315            DEEEAAFLAEQVEHFNRERKDIVATITEEAMAMAETKVKKGDLFLLLAKENWHEGVLGIV
    NCTC8325        VEEEAAFLAEQVEHFNRERKDIVATITEEAMAMAETKVKKGDLFLLLAKENWHEGVLGIV
    Newman          VEEEAAFLAEQVEHFNRERKDIVATITEEAMAMAETKVKKGDLFLLLAKENWHEGVLGIV
    USA300_FPR3757  VEEEAAFLAEQVEHFNRERKDIVATITEEAMAMAETKVKKGDLFLLLAKENWHEGVLGIV
                     ***********************************************************

    COL             ASKIVETFALPTLILNIDREQNHAKGSARSIDQVSMFEILSAHQELIAKFGGHHMAAGMT
    N315            ASKIVETFALPTLILNIDREQNHAKGSARSIDQVSMFEILSAHQELIAKFGGHHMAAGMT
    NCTC8325        ASKIVETFALPTLILNIDREQNHAKGSARSIDQVSMFEILSAHQELIAKFGGHHMAAGMT
    Newman          ASKIVETFALPTLILNIDREQNHAKGSARSIDQVSMFEILSAHQELIAKFGGHHMAAGMT
    USA300_FPR3757  ASKIVETFALPTLILNIDREQNHAKGSARSIDQVSMFEILSAHQELIAKFGGHHMAAGMT
                    ************************************************************

    COL             MDIENIESLAEGLNKWMKELSKTTSLDPVKQVDVLLTENDITIKNIRDMNRLRPFGTDFS
    N315            MDIENIESLAEGLNKWMKELSKTTSLDPVKPVDVLLTENDITIKNIRDMNRLRPFGTDFS
    NCTC8325        MDIENIESLAEGLNKWMKELSKTTSLDPVKQVDVLLTENDITIKNIRDMNRLRPFGTDFS
    Newman          MDIENIESLAEGLNKWMKELSKTTSLDPVKQVDVLLTENDITIKNIRDMNRLRPFGTDFS
    USA300_FPR3757  MDIENIESLAEGLNKWMKELSKTTSLDPVKQVDVLLTENDITIKNIRDMNRLRPFGTDFS
                    ****************************** *****************************

    COL             RPIFEMDDLSVSSVKAIGQQKNHLKLTLGESNIAALFWQNGHLEPELQDEQPINILGSVQ
    N315            RPIFEMDDLSVSSVKAIGQQKNHLKLTLGESNIAALFWQNGHLEPELQDEQPINILGSVQ
    NCTC8325        RPIFEMDDLSVSSVKAIGQQKNHLKLTLGESNIAALFWQNGHLEPELQDEQPINILGSVQ
    Newman          RPIFEMDDLSVSSVKAIGQQKNHLKLTLGESNIAALFWQNGHLEPELQDEQPINILGSVQ
    USA300_FPR3757  RPIFEMDDLSVSSVKAIGQQKNHLKLTLGESNIAALFWQNGHLEPELQDEQPINILGSVQ
                    ************************************************************

    COL             INEWNGNQSPQIIIQDIAMNEQQILDYRSKRKSLPFTENDENIVVLIHPKSDKVNANEYY
    N315            INEWNGNQSPQLIIQDIAMNEQQILDYRSKRKSLPFTENDENIVVLIHPKSDKVNANEYY
    NCTC8325        INEWNGNQSPQIIIQDIAMNEQQILDYRSKRKSLPFTENDENIVVLIHPKSDKVNANEYY
    Newman          INEWNGNQSPQIIIQDIAMNEQQILDYRSKRKSLPFTENDENIVVLIHPKSDKVNANEYY
    USA300_FPR3757  INEWNGNQSPQIIIQDIAMNEQQILDYRSKRKSLPFTENDENIVVLIHPKSDKVNANEYY
                    ***********:************************************************

    COL             YGEEIKQQTDKVVLRDLPTSMEDLSNSLQQLQFSQLYIVLQHNHSIYFDGIPNMDIFKKC
    N315            YGEEIKQQTDKVVLRDLPTSMEDLSNSLQQLQFSQLYIVLQHNHSIYFDGIPNMDIFKKC
    NCTC8325        YGEEIKQQTDKVVLRDLPTSMEDLSNSLQQLQFSQLYIVLQHNHSIYFDGIPNMDIFKKC
    Newman          YGEEIKQQTDKVVLRDLPTSMEDLSNSLQQLQFSQLYIVLQHNHSIYFDGIPNMDIFKKC
    USA300_FPR3757  YGEEIKQQTDKVVLRDLPTSMEDLSNSLQQLQFSQLYIVLQHNHSIYFDGIPNMDIFKKC
                    ************************************************************

    COL             YKALITKQETNIQKEGMLLCQHLSVKPDTLKFMLKVFLDLKFVTQEDGLIRINQQPDKRS
    N315            YKALITKQETNIQKEGMLLCQHLSVKPDTLKFMLKVFLDLKFVTQEDGLIRINQQPDKRS
    NCTC8325        YKALITKQETNIQKEGMLLCQHLSVKPDTLKFMLKVFLDLKFVTQEDGLIRINQQPDKRS
    Newman          YKALITKQETNIQKEGMLLCQHLSVKPDTLKFMLKVFLDLKFVTQEDGLIRINQQPDKRS
    USA300_FPR3757  YKALITKQETNIQKEGMLLCQHLSVKPDTLKFMLKVFLDLKFVTQEDGLIRINQQPDKRS
                    ************************************************************

    COL             IDSSKVYQLRQQRMDVEKQLLYQDFSEIKNWIKSQLS
    N315            IDSSKVYQLRQQRMDVEKQLLYQDFSEIKNWIKSQLS
    NCTC8325        IDSSKVYQLRQQRMDVEKQLLYQDFSEIKNWIKSQLS
    Newman          IDSSKVYQLRQQRMDVEKQLLYQDFSEIKNWIKSQLS
    USA300_FPR3757  IDSSKVYQLRQQRMDVEKQLLYQDFSEIKNWIKSQLS
                    *************************************