From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004248000
  • symbol?: ruvA
  • description?: Holliday junction DNA helicase RuvA

      descriptions from strain specific annotations:

    • Holliday junction DNA helicase RuvA
    • Holliday junction ATP-dependent DNA helicase RuvA
    • Holliday junction DNA helicase subunit RuvA
    • crossover junction endodeoxyribonuclease
    • crossover junction ATP-dependent DNA helicase RuvA
  • strand?: -
  • coordinates?: 4495966..4496568
  • synteny block?: BlockID0032760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1697 (ruvA)
    N315:
    SA1468 (ruvA)
    NCTC8325:
    Newman:
    NWMN_1544 (ruvA)
    USA300_FPR3757:
    04-02981:
    SA2981_1600 (ruvA)
    08BA02176:
    C248_1685 (ruvA)
    11819-97:
    MS7_1657 (ruvA)
    71193:
    ST398NM01_1705
    ECT-R 2:
    ECTR2_1490 (ruvA)
    ED133:
    SAOV_1639 (ruvA)
    ED98:
    SAAV_1635 (ruvA)
    HO 5096 0412:
    SAEMRSA15_15590 (ruvA)
    JH1:
    SaurJH1_1732 (ruvA)
    JH9:
    SaurJH9_1699 (ruvA)
    JKD6008:
    SAA6008_01611 (ruvA)
    JKD6159:
    SAA6159_01574 (ruvA)
    LGA251:
    SARLGA251_15440 (ruvA)
    M013:
    M013TW_1662
    MRSA252:
    SAR1722 (ruvA)
    MSHR1132:
    SAMSHR1132_14780
    MSSA476:
    SAS1578 (ruvA)
    Mu3:
    SAHV_1629 (ruvA)
    Mu50:
    SAV1642 (ruvA)
    MW2:
    MW1592 (ruvA)
    RF122:
    SAB1511c (ruvA)
    ST398:
    SAPIG1705 (ruvA)
    T0131:
    SAT0131_01742
    TCH60:
    HMPREF0772_11500 (ruvA)
    TW20:
    SATW20_16360 (ruvA)
    USA300_TCH1516:
    USA300HOU_1641 (ruvA)
    VC40:
    SAVC_07455 (ruvA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
    N315            MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIRTSLIVREDAQLLY
    NCTC8325        MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
    Newman          MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
    USA300_FPR3757  MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
                    **********************************************:*************

    COL             GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
    N315            GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
    NCTC8325        GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
    Newman          GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
    USA300_FPR3757  GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
                    ************************************************************

    COL             RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
    N315            RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
    NCTC8325        RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
    Newman          RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
    USA300_FPR3757  RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
                    ************************************************************

    COL             KNKYDSVDEAVKAGLQLVVS
    N315            KNKYDSVDEAVKAGLQLVVS
    NCTC8325        KNKYDSVDEAVKAGLQLVVS
    Newman          KNKYDSVDEAVKAGLQLVVS
    USA300_FPR3757  KNKYDSVDEAVKAGLQLVVS
                    ********************