From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004295000
  • symbol?:
  • description?: DNA mismatch repair protein MutT

      descriptions from strain specific annotations:

    • DNA mismatch repair protein MutT
    • MutT/nudix family protein
    • MutT/Nudix hydrolase family protein
    • NUDIX domain-containing protein
    • NUDIX hydrolase
  • strand?: -
  • coordinates?: 4538661..4539269
  • synteny block?: BlockID0033190
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1637
    08BA02176:
    C248_1719
    11819-97:
    MS7_1685
    71193:
    ST398NM01_1732
    ECT-R 2:
    ECTR2_1518
    ED133:
    SAOV_1666
    ED98:
    SAAV_1665
    HO 5096 0412:
    SAEMRSA15_15880
    JH1:
    SaurJH1_1769
    JH9:
    SaurJH9_1735
    JKD6008:
    SAA6008_01645
    JKD6159:
    SAA6159_01602
    LGA251:
    SARLGA251_15700
    M013:
    M013TW_1691
    MRSA252:
    SAR1757
    MSHR1132:
    SAMSHR1132_15050
    MSSA476:
    SAS1606
    Mu3:
    SAHV_1664
    Mu50:
    SAV1677
    MW2:
    MW1621
    RF122:
    SAB1537c
    ST398:
    SAPIG1732
    T0131:
    SAT0131_01780
    TCH60:
    HMPREF0772_11473
    TW20:
    SATW20_16680
    USA300_TCH1516:
    VC40:
    SAVC_07595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKFDEQIIVVPREIIFNNEKNTFNGFLNKNKPEGQNIFDALSQYEVKRRGDMEEDPSYK
    N315            MSKFDEQIIVVPREIIFNNEKNTFNGFLNKNKPEGQNIFDALSQYEVKRRGDMEEDPSYK
    NCTC8325        MSKFDEQIIVVPREIIFNNEKNTFNGFLNKNKPEGQNIFDALSQYEVKRRGDMEEDPSYK
    Newman          MSKFDEQIIVVPREIIFNNEKNTFNGFLNKNKPEGQNIFDALSQYEVKRRGDMEEDPSYK
    USA300_FPR3757  MSKFDEQIIVVPREIIFNNEKNTFNGFLNKNKPEGQNIFDALSQYEVKRRGDMEEDPSYK
                    ************************************************************

    COL             QLISYCLLENEHGEILVYERLSGGGEARLHGQSSIGVGGHMNDVPGAESINEVLRVNAQR
    N315            QLISYCLLENEHGEILVYERLSGGGEARLHGQSSIGVGGHMNDVPGAESINEVLRVNAQR
    NCTC8325        QLISYCLLENEHGEILVYERLSGGGEARLHGQSSIGVGGHMNDVPGAESINEVLRVNAQR
    Newman          QLISYCLLENEHGEILVYERLSGGGEARLHGQSSIGVGGHMNDVPGAESINEVLRVNAQR
    USA300_FPR3757  QLISYCLLENEHGEILVYERLSGGGEARLHGQSSIGVGGHMNDVPGAESINEVLRVNAQR
                    ************************************************************

    COL             ELEEEVGLSEQDSQNMEYIGFINDDNNEVGKVHIGVVFKITVSTNDVEAKETDTLRIKWV
    N315            ELEEEVGLSEQDSQNMEYIGFINDDNNEVGKVHIGVVFKITVSTNDVEAKETDTLRIKWV
    NCTC8325        ELEEEVGLSEQDSQNMEYIGFINDDNNEVGKVHIGVVFKITVSTNDVEAKETDTLRIKWV
    Newman          ELEEEVGLSEQDSQNMEYIGFINDDNNEVGKVHIGVVFKITVSTNDVEAKETDTLRIKWV
    USA300_FPR3757  ELEEEVGLSEQDSQNMEYIGFINDDNNEVGKVHIGVVFKITVSTNDVEAKETDTLRIKWV
                    ************************************************************

    COL             EKGNIESYDDFETWSALILQDL
    N315            EKGNIESYDDFETWSALILQDL
    NCTC8325        EKGNIESYDDFETWSALILQDL
    Newman          EKGNIESYDDFETWSALILQDL
    USA300_FPR3757  EKGNIESYDDFETWSALILQDL
                    **********************