From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004298000
  • symbol?: rpmI
  • description?: 50S ribosomal protein L35
  • strand?: -
  • coordinates?: 4539818..4540018
  • synteny block?: BlockID0033220
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1726 (rpmI)
    N315:
    SA1503 (rpmI)
    NCTC8325:
    Newman:
    NWMN_1573 (rpmI)
    USA300_FPR3757:
    04-02981:
    SA2981_1639 (rpmI)
    08BA02176:
    C248_1721 (rpmI)
    11819-97:
    MS7_1687 (rpmI)
    71193:
    ST398NM01_1734
    ECT-R 2:
    ECTR2_1520 (rpmI)
    ED133:
    SAOV_1668 (rpmI)
    ED98:
    SAAV_1667 (rpmI)
    HO 5096 0412:
    SAEMRSA15_15900 (rpmI)
    JH1:
    SaurJH1_1771 (rpmI)
    JH9:
    SaurJH9_1737 (rpmI)
    JKD6008:
    SAA6008_01647 (rpmI)
    JKD6159:
    SAA6159_01604 (rpmI)
    LGA251:
    SARLGA251_15720 (rpmI)
    M013:
    M013TW_1693
    MRSA252:
    SAR1759 (rpmI)
    MSHR1132:
    SAMSHR1132_15070
    MSSA476:
    SAS1608 (rpmI)
    Mu3:
    SAHV_1666 (rpmI)
    Mu50:
    SAV1679 (rpmI)
    MW2:
    MW1623 (rpmI)
    RF122:
    SAB1539c (rpmI)
    ST398:
    SAPIG1734 (rpmI)
    T0131:
    SAT0131_01782 (adhA)
    TCH60:
    HMPREF0772_11471 (rpmI)
    TW20:
    SATW20_16700 (rpmI)
    USA300_TCH1516:
    VC40:
    SAVC_07605 (rpmI)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQ
    N315            MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQ
    NCTC8325        MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQ
    Newman          MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQ
    USA300_FPR3757  MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQ
                    ************************************************************

    COL             LLAYKK
    N315            LLAYKK
    NCTC8325        LLAYKK
    Newman          LLAYKK
    USA300_FPR3757  LLAYKK
                    ******