From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004306000
  • symbol?: dnaI
  • description?: primosomal protein DnaI

      descriptions from strain specific annotations:

    • primosomal protein DnaI
    • Helicase loader DnaI
    • putative primosomal protein
    • Replicative DNA helicase loader DnaI
  • strand?: -
  • coordinates?: 4545090..4546010
  • synteny block?: BlockID0033300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1731 (dnaI)
    N315:
    SA1507 (dnaI)
    NCTC8325:
    Newman:
    NWMN_1577 (dnaI)
    USA300_FPR3757:
    04-02981:
    SA2981_1643 (dnaI)
    08BA02176:
    C248_1726 (dnaI)
    11819-97:
    MS7_1691 (dnaI)
    71193:
    ST398NM01_1738
    ECT-R 2:
    ECTR2_1524
    ED133:
    SAOV_1672 (dnaI)
    ED98:
    SAAV_1674 (dnaI)
    HO 5096 0412:
    SAEMRSA15_15940 (dnaI)
    JH1:
    SaurJH1_1775
    JH9:
    SaurJH9_1741
    JKD6008:
    SAA6008_01651 (dnaI)
    JKD6159:
    SAA6159_01608 (dnaI)
    LGA251:
    SARLGA251_15760 (dnaI)
    M013:
    M013TW_1697
    MRSA252:
    SAR1763 (dnaI)
    MSHR1132:
    SAMSHR1132_15110
    MSSA476:
    SAS1612
    Mu3:
    SAHV_1670 (dnaI)
    Mu50:
    SAV1684 (dnaI)
    MW2:
    MW1627 (dnaI)
    RF122:
    SAB1543c (dnaI)
    ST398:
    SAPIG1738
    T0131:
    SAT0131_01786
    TCH60:
    HMPREF0772_11467 (dnaI)
    TW20:
    SATW20_16740 (dnaI)
    USA300_TCH1516:
    USA300HOU_1671 (dnaI)
    VC40:
    SAVC_07625

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQFKSIINTSQDFEKRIEKIKKEVINDPDVKQFLEAHRAELTNAMIDEDLNVLQEYKDQ
    N315            MKQFKSIINTSQDFEKRIEKIKKEVINDPDVKQFLEAHRAELTNAMIDEDLNVLQEYKDQ
    NCTC8325        MKQFKSIINTSQDFEKRIEKIKKEVINDPDVKQFLEAHRAELTNAMIDEDLNVLQEYKDQ
    Newman          MKQFKSIINTSQDFEKRIEKIKKEVINDPDVKQFLEAHRAELTNAMIDEDLNVLQEYKDQ
    USA300_FPR3757  MKQFKSIINTSQDFEKRIEKIKKEVINDPDVKQFLEAHRAELTNAMIDEDLNVLQEYKDQ
                    ************************************************************

    COL             QKHYDGHKFADCPNFVKGHVPELYVDNNRIKIRYLQCPCKIKYDEERFEAELITSHHMQR
    N315            QKHYDGHKFADCPNFVKGHVPELYVDNNRIKIRYLQCPCKIKYDEERFEAELITSHHMQR
    NCTC8325        QKHYDGHKFADCPNFVKGHVPELYVDNNRIKIRYLQCPCKIKYDEERFEAELITSHHMQR
    Newman          QKHYDGHKFADCPNFVKGHVPELYVDNNRIKIRYLQCPCKIKYDEERFEAELITSHHMQR
    USA300_FPR3757  QKHYDGHKFADCPNFVKGHVPELYVDNNRIKIRYLQCPCKIKYDEERFEAELITSHHMQR
                    ************************************************************

    COL             DTLNAKLKDIYMNHRDRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQ
    N315            DTLNAKLKDIYMNHRDRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQ
    NCTC8325        DTLNAKLKDIYMNHRDRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQ
    Newman          DTLNAKLKDIYMNHRDRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQ
    USA300_FPR3757  DTLNAKLKDIYMNHRDRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQ
                    ************************************************************

    COL             LKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEV
    N315            LKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEV
    NCTC8325        LKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEV
    Newman          LKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEV
    USA300_FPR3757  LKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEV
                    ************************************************************

    COL             IGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
    N315            IGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
    NCTC8325        IGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
    Newman          IGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
    USA300_FPR3757  IGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
                    ************************************************************

    COL             ENFRNN
    N315            ENFRNN
    NCTC8325        ENFRNN
    Newman          ENFRNN
    USA300_FPR3757  ENFRNN
                    ******