From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004308000
  • symbol?: nrdR
  • description?: transcriptional regulator NrdR

      descriptions from strain specific annotations:

    • transcriptional regulator NrdR
    • Ribonucleotide reductase transcriptional regulator NrdR
    • hypothetical protein0168 protein
    • NrdR family transcriptional regulator
    • regulatory protein
    • Transcriptional repressor NrdR
  • strand?: -
  • coordinates?: 4547434..4547904
  • synteny block?: BlockID0033320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1733 (nrdR)
    N315:
    SA1509 (nrdR)
    NCTC8325:
    Newman:
    NWMN_1579 (nrdR)
    USA300_FPR3757:
    04-02981:
    SA2981_1645 (nrdR)
    08BA02176:
    C248_1728
    11819-97:
    MS7_1693 (nrdR)
    71193:
    ST398NM01_1740
    ECT-R 2:
    ECTR2_1526 (nrdR)
    ED133:
    SAOV_1674
    ED98:
    SAAV_1676 (nrdR)
    HO 5096 0412:
    SAEMRSA15_15960
    JH1:
    SaurJH1_1777 (nrdR)
    JH9:
    SaurJH9_1743 (nrdR)
    JKD6008:
    SAA6008_01653 (nrdR)
    JKD6159:
    SAA6159_01610 (nrdR)
    LGA251:
    SARLGA251_15780
    M013:
    M013TW_1699
    MRSA252:
    SAR1765 (nrdR)
    MSHR1132:
    SAMSHR1132_15130
    MSSA476:
    SAS1614 (nrdR)
    Mu3:
    SAHV_1672 (nrdR)
    Mu50:
    SAV1686 (nrdR)
    MW2:
    MW1629 (nrdR)
    RF122:
    SAB1545c (nrdR)
    ST398:
    SAPIG1740 (nrdR)
    T0131:
    SAT0131_01788
    TCH60:
    HMPREF0772_11465 (nrdR)
    TW20:
    SATW20_16760
    USA300_TCH1516:
    USA300HOU_1673 (nrdR)
    VC40:
    SAVC_07635 (nrdR)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
    N315            MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
    NCTC8325        MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
    Newman          MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
    USA300_FPR3757  MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
                    ************************************************************

    COL             FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVD
    N315            FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVD
    NCTC8325        FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVD
    Newman          FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVD
    USA300_FPR3757  FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVD
                    ************************************************************

    COL             QVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
    N315            QVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
    NCTC8325        QVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
    Newman          QVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
    USA300_FPR3757  QVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
                    ************************************