From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004321000
  • symbol?: aapA
  • description?: alanine glycine permease

      descriptions from strain specific annotations:

    • alanine glycine permease
    • D-serine/D-alanine/glycine transporter
    • amino acid permease
    • Amino acid permease-associated region
    • amino acid permease family protein
    • APC family amino acid-polyamine-organocation transporter
    • D-serine, D-alanine, glycine transporter
    • putative D-serine/D-alanine/glycine transporter
  • strand?: +
  • coordinates?: 4563267..4564628
  • synteny block?: BlockID0033450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1519 (aapA)
    NCTC8325:
    Newman:
    NWMN_1589 (aapA)
    USA300_FPR3757:
    04-02981:
    SA2981_1655 (aapA)
    08BA02176:
    C248_1738 (cycA)
    11819-97:
    MS7_1703
    71193:
    ST398NM01_1750
    ECT-R 2:
    ECTR2_1536
    ED133:
    SAOV_1684 (cycA)
    ED98:
    SAAV_1686
    HO 5096 0412:
    SAEMRSA15_16060 (cycA)
    JH1:
    SaurJH1_1787
    JH9:
    SaurJH9_1753
    JKD6008:
    SAA6008_01663
    JKD6159:
    SAA6159_01620
    LGA251:
    SARLGA251_15880 (cycA)
    M013:
    M013TW_1709
    MRSA252:
    SAR1775 (cycA)
    MSHR1132:
    SAMSHR1132_15470
    MSSA476:
    SAS1624
    Mu3:
    SAHV_1682 (aapA)
    Mu50:
    SAV1696 (aapA)
    MW2:
    MW1640 (aapA)
    RF122:
    SAB1555 (cycA)
    ST398:
    SAPIG1750
    T0131:
    SAT0131_01798 (opp1B)
    TCH60:
    HMPREF0772_11455 (cycA2)
    TW20:
    SATW20_16860 (cycA)
    USA300_TCH1516:
    USA300HOU_1683
    VC40:
    SAVC_07685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAEKLQRELSNRHIQLIAIGGAIGTGLFLGAGQTIALTGPSILLTYIIIGFMLFMFMRGL
    N315            MAEKLQRELSNRHIQLIAIGGAIGTGLFLGAGQTIALTGPSILLTYIIIGFMLFMFMRGL
    NCTC8325        MAEKLQRELSNRHIQLIAIGGAIGTGLFLGAGQTIALTGPSILLTYIIIGFMLFMFMRGL
    Newman          MAEKLQRELSNRHIQLIAIGGAIGTGLFLGAGQTIALTGPSILLTYIIIGFMLFMFMRGL
    USA300_FPR3757  MAEKLQRELSNRHIQLIAIGGAIGTGLFLGAGQTIALTGPSILLTYIIIGFMLFMFMRGL
                    ************************************************************

    COL             GEIIIQNTEFKSFADVTNTYIGPFAGFVTGWTYWFCWIITGMAEVTAVAKYVSFWFPEIP
    N315            GEIIIQNTEFKSFADVTNTYIGPFAGFVTGWTYWFCWIITGMAEVTAVAKYVSFWFPEIP
    NCTC8325        GEIIIQNTEFKSFADVTNTYIGPFAGFVTGWTYWFCWIITGMAEVTAVAKYVSFWFPEIP
    Newman          GEIIIQNTEFKSFADVTNTYIGPFAGFVTGWTYWFCWIITGMAEVTAVAKYVSFWFPEIP
    USA300_FPR3757  GEIIIQNTEFKSFADVTNTYIGPFAGFVTGWTYWFCWIITGMAEVTAVAKYVSFWFPEIP
                    ************************************************************

    COL             NWISALFCVLLLMSFNLLSARLFGELEFWFSIIKIATIIGLIVVGFVMILFAFKTQFGHA
    N315            NWISALFCVLLLMSFNLLSARLFGELEFWFSIIKIATIIGLIVVGFVMILFAFKTQFGHA
    NCTC8325        NWISALFCVLLLMSFNLLSARLFGELEFWFSIIKIATIIGLIVVGFVMILFAFKTQFGHA
    Newman          NWISALFCVLLLMSFNLLSARLFGELEFWFSIIKIATIIGLIVVGFVMILFAFKTQFGHA
    USA300_FPR3757  NWISALFCVLLLMSFNLLSARLFGELEFWFSIIKIATIIGLIVVGFVMILFAFKTQFGHA
                    ************************************************************

    COL             SFTNLYEHGIFAKGASGFFMSFQMALFSFVGIEMIGVTAGETKDPVKTIPKAINSVPIRI
    N315            SFTNLYEHGIFAKGASGFFMSFQMALFSFVGIEMIGVTAGETKDPVKTIPKAINSVPIRI
    NCTC8325        SFTNLYEHGIFAKGASGFFMSFQMALFSFVGIEMIGVTAGETKDPVKTIPKAINSVPIRI
    Newman          SFTNLYEHGIFAKGASGFFMSFQMALFSFVGIEMIGVTAGETKDPVKTIPKAINSVPIRI
    USA300_FPR3757  SFTNLYEHGIFAKGASGFFMSFQMALFSFVGIEMIGVTAGETKDPVKTIPKAINSVPIRI
                    ************************************************************

    COL             LIFYVGALAVIMSIIPWQQVDPDNSPFVKLFALIGIPFAAGLINFVVLTAAASSCNSGIF
    N315            LIFYVGALAVIMSIIPWQQVDPDNSPFVKLFALIGIPFAAGLINFVVLTAAASSCNSGIF
    NCTC8325        LIFYVGALAVIMSIIPWQQVDPDNSPFVKLFALIGIPFAAGLINFVVLTAAASSCNSGIF
    Newman          LIFYVGALAVIMSIIPWQQVDPDNSPFVKLFALIGIPFAAGLINFVVLTAAASSCNSGIF
    USA300_FPR3757  LIFYVGALAVIMSIIPWQQVDPDNSPFVKLFALIGIPFAAGLINFVVLTAAASSCNSGIF
                    ************************************************************

    COL             SNSRMLFGLSSQQQAPPNFSKTNKYGVPHVAIFASSALLLVAALLNYIFPDATKVFTYVT
    N315            SNSRMLFGLSSQQQAPPNFSKTNKYGVPHVAIFASSALLLVAALLNYIFPDATKVFTYVT
    NCTC8325        SNSRMLFGLSSQQQAPPNFSKTNKYGVPHVAIFASSALLLVAALLNYIFPDATKVFTYVT
    Newman          SNSRMLFGLSSQQQAPPNFSKTNKYGVPHVAIFASSALLLVAALLNYIFPDATKVFTYVT
    USA300_FPR3757  SNSRMLFGLSSQQQAPPNFSKTNKYGVPHVAIFASSALLLVAALLNYIFPDATKVFTYVT
                    ************************************************************

    COL             TISTVLFLVVWGLIIIAYINYSRKNPDLHKNATYKLLGGKYMGYLIFVFFIFVFGLLFIN
    N315            TISTVLFLVVWGLIIIAYINYSRKNPDLHKNATYKLLGGKYMGYLIFVFFIFVFGLLFIN
    NCTC8325        TISTVLFLVVWGLIIIAYINYSRKNPDLHKNATYKLLGGKYMGYLIFVFFIFVFGLLFIN
    Newman          TISTVLFLVVWGLIIIAYINYSRKNPDLHKNATYKLLGGKYMGYLIFVFFIFVFGLLFIN
    USA300_FPR3757  TISTVLFLVVWGLIIIAYINYSRKNPDLHKNATYKLLGGKYMGYLIFVFFIFVFGLLFIN
                    ************************************************************

    COL             VDTRRAIYFIPIWFILLAFMYLRYKRIAAKSNK
    N315            VDTRRAIYFIPIWFILLAFMYLRYKRIAAKSNK
    NCTC8325        VDTRRAIYFIPIWFILLAFMYLRYKRIAAKSNK
    Newman          VDTRRAIYFIPIWFILLAFMYLRYKRIAAKSNK
    USA300_FPR3757  VDTRRAIYFIPIWFILLAFMYLRYKRIAAKSNK
                    *********************************