From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004358000
  • symbol?:
  • description?: metal-dependent hydrolase

      descriptions from strain specific annotations:

    • metal-dependent hydrolase
    • metallo-beta-lactamase superfamily protein
    • pseudogene
  • strand?: -
  • coordinates?: 4598508..4599026
  • synteny block?: BlockID0033630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1665
    08BA02176:
    C248_1748
    11819-97:
    MS7_1713
    71193:
    ST398NM01_1760
    ECT-R 2:
    ECTR2_1547
    ED133:
    SAOV_1694
    ED98:
    SAAV_1716
    HO 5096 0412:
    SAEMRSA15_16160
    JH1:
    SaurJH1_1797
    JH9:
    SaurJH9_1763
    JKD6008:
    SAA6008_01675
    JKD6159:
    SAA6159_01631
    LGA251:
    SARLGA251_15980
    M013:
    M013TW_1719
    MRSA252:
    SAR1785
    MSHR1132:
    SAMSHR1132_15570
    MSSA476:
    SAS1634
    Mu3:
    SAHV_1693
    Mu50:
    SAV1707
    MW2:
    MW1650
    RF122:
    SAB1566c
    ST398:
    SAPIG1760
    T0131:
    SAT0131_01810 (mntC)
    TCH60:
    HMPREF0772_11445
    TW20:
    SATW20_16980
    USA300_TCH1516:
    USA300HOU_1693
    VC40:
    SAVC_07745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKLSFHGQSTIYLEGNNKKVIVDPFISNNPKCDLNIETVQVDYIVLTHGHFDHFGDVVEL
    NCTC8325        MKLSFHGQSTIYLEGNNKKVIVDPFISNNPKCDLNIETVQVDYIVLTHGHFDHFGDVVEL
    Newman          MKLSFHGQSTIYLEGNNKKVIVDPFISNNPKCDLNIETVQVDYIVLTHGHFDHFGDVVEL
    USA300_FPR3757  MKLSFHGQSTIYLEGNNKKVIVDPFISNNPKCDLNIETVQVDYIVLTHGHFDHFGDVVEL
                    ************************************************************

    N315            AKKTGATVIGSAEMADYLSSYHGVENVHGMNIGGKANFDFGSVKFVQAFHSSSFTHENGI
    NCTC8325        AKKTGATVIGSAEMADYLSSYHGVENVHGMNIGGKANFDFGSVKFVQAFHSSSFTHENGI
    Newman          AKKTGATVIGSAEMADYLSSYHGVENVHGMNIGGKANFDFGSVKFVQAFHSSSFTHENGI
    USA300_FPR3757  AKKTGATVIGSAEMADYLSSYHGVENVHGMNIGGKANFDFGSVKFVQAFHSSSFTHENGI
                    ************************************************************

    N315            PVYLGMPMGIVFEVEGKTIYHTGDTGLFSDMSLIAKRHPVDVCFVPIGDNFTMGIDDASY
    NCTC8325        PVYLGMPMGIVFEVEGKTIYHTGDTGLFSDMSLIAKRHPVDVCFVPIGDNFTMGIDDASY
    Newman          PVYLGMPMGIVFEVEGKTIYHTGDTGLFSDMSLIAKRHPVDVCFVPIGDNFTMGIDDASY
    USA300_FPR3757  PVYLGMPMGIVFEVEGKTIYHTGDTGLFSDMSLIAKRHPVDVCFVPIGDNFTMGIDDASY
                    ************************************************************

    N315            AINEFIKPKISVPIHYDTFPLIEQDPQQFKDAVNVGDVQILKPGESVQF
    NCTC8325        AINEFIKPKISVPIHYDTFPLIEQDPQQFKDAVNVGDVQILKPGESVQF
    Newman          AINEFIKPKISVPIHYDTFPLIEQDPQQFKDAVNVGDVQILKPGESVQF
    USA300_FPR3757  AINEFIKPKISVPIHYDTFPLIEQDPQQFKDAVNVGDVQILKPGESVQF
                    *************************************************