From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004372000
  • symbol?: rpsD
  • description?: 30S ribosomal protein S4
  • strand?: +
  • coordinates?: 4612111..4612713
  • synteny block?: BlockID0033770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1769 (rpsD)
    N315:
    SAS052 (rpsD)
    NCTC8325:
    Newman:
    NWMN_1613 (rpsD)
    USA300_FPR3757:
    04-02981:
    SA2981_1678 (rpsD)
    08BA02176:
    C248_1760 (rpsD)
    11819-97:
    MS7_1726 (rpsD)
    71193:
    ST398NM01_1772
    ECT-R 2:
    ECTR2_1560 (rpsD)
    ED133:
    SAOV_1706 (rpsD)
    ED98:
    SAAV_1730 (rpsD)
    HO 5096 0412:
    SAEMRSA15_16280 (rpsD)
    JH1:
    SaurJH1_1810 (rpsD)
    JH9:
    SaurJH9_1775 (rpsD)
    JKD6008:
    SAA6008_01688 (rpsD)
    JKD6159:
    SAA6159_01643 (rpsD)
    LGA251:
    SARLGA251_16100 (rpsD)
    M013:
    M013TW_1732
    MRSA252:
    SAR1797 (rpsD)
    MSHR1132:
    SAMSHR1132_15690
    MSSA476:
    SAS1646 (rpsD)
    Mu3:
    SAHV_1705 (rpsD)
    Mu50:
    SAV1719 (rpsD)
    MW2:
    MW1662 (rpsD)
    RF122:
    SAB1578 (rpsD)
    ST398:
    SAPIG1772 (rpsD)
    T0131:
    SAT0131_01823
    TCH60:
    HMPREF0772_11433 (rpsD)
    TW20:
    SATW20_17100 (rpsD)
    USA300_TCH1516:
    USA300HOU_1707 (rpsD)
    VC40:
    SAVC_07805 (rpsD)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYL
    N315            MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYL
    NCTC8325        MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYL
    Newman          MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYL
    USA300_FPR3757  MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYL
                    ************************************************************

    COL             YGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHIL
    N315            YGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHIL
    NCTC8325        YGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHIL
    Newman          YGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHIL
    USA300_FPR3757  YGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHIL
                    ************************************************************

    COL             VDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLP
    N315            VDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLP
    NCTC8325        VDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLP
    Newman          VDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLP
    USA300_FPR3757  VDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLP
                    ************************************************************

    COL             ERSELPAEINEQLIVEYYSR
    N315            ERSELPAEINEQLIVEYYSR
    NCTC8325        ERSELPAEINEQLIVEYYSR
    Newman          ERSELPAEINEQLIVEYYSR
    USA300_FPR3757  ERSELPAEINEQLIVEYYSR
                    ********************