From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004375000
  • symbol?:
  • description?: glycerophosphoryl diester phosphodiesterase

      descriptions from strain specific annotations:

    • glycerophosphoryl diester phosphodiesterase
    • glycerophosphoryl diester phosphodiesterase, putative
    • glycerophosphoryl diester phosphodiesterase family protein
    • putative glycerophosphoryl diester phosphodiesterase
    • glycerophosphodiester phosphodiesterase
    • glycerophosphoryl diester phosphodiesterase protein
  • strand?: -
  • coordinates?: 4614451..4615367
  • synteny block?: BlockID0033800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1679
    08BA02176:
    C248_1761
    11819-97:
    MS7_1727
    71193:
    ST398NM01_1773
    ECT-R 2:
    ECTR2_1561
    ED133:
    SAOV_1707
    ED98:
    SAAV_1731
    HO 5096 0412:
    SAEMRSA15_16290
    JH1:
    SaurJH1_1811
    JH9:
    SaurJH9_1776
    JKD6008:
    SAA6008_01689
    JKD6159:
    SAA6159_01644
    LGA251:
    SARLGA251_16110
    M013:
    M013TW_1733
    MRSA252:
    SAR1798
    MSHR1132:
    SAMSHR1132_15700
    MSSA476:
    SAS1647
    Mu3:
    SAHV_1707
    Mu50:
    SAV1721
    MW2:
    MW1663
    RF122:
    SAB1579c
    ST398:
    SAPIG1773
    T0131:
    SAT0131_01824 (tagX)
    TCH60:
    HMPREF0772_11432 (glpQ3)
    TW20:
    SATW20_17110
    USA300_TCH1516:
    USA300HOU_1709 (ugpQ2)
    VC40:
    SAVC_07810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
    N315            MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
    NCTC8325        MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
    Newman          MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
    USA300_FPR3757  MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
                    ************************************************************

    COL             IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
    N315            IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
    NCTC8325        IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
    Newman          IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
    USA300_FPR3757  IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
                    ************************************************************

    COL             PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
    N315            PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLSSKRNYWYKK
    NCTC8325        PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
    Newman          PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
    USA300_FPR3757  PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
                    **************************************************.*********

    COL             PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
    N315            PNFSRIAQIASYVNPNYALVARKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
    NCTC8325        PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
    Newman          PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
    USA300_FPR3757  PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
                    ********************:***************************************

    COL             NPKLFIK
    N315            NPKLFIK
    NCTC8325        NPKLFIK
    Newman          NPKLFIK
    USA300_FPR3757  NPKLFIK
                    *******