From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004384000
  • symbol?:
  • description?: HAD family hydrolase

      descriptions from strain specific annotations:

    • HAD family hydrolase
    • HAD superfamily hydrolase
    • Phosphoserine phosphatase, putative
    • haloacid dehalogenase-like hydrolase
    • Hpr(Ser) kinase
    • phosphatase-like protein
  • strand?: -
  • coordinates?: 4622185..4623225
  • synteny block?: BlockID0033880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1683
    08BA02176:
    C248_1767
    11819-97:
    MS7_1731
    71193:
    ST398NM01_1777
    ECT-R 2:
    ECTR2_1565
    ED133:
    SAOV_1711
    ED98:
    SAAV_1735
    HO 5096 0412:
    SAEMRSA15_16330
    JH1:
    SaurJH1_1815
    JH9:
    SaurJH9_1780
    JKD6008:
    SAA6008_01693
    JKD6159:
    SAA6159_01648
    LGA251:
    SARLGA251_16150
    M013:
    M013TW_1739
    MRSA252:
    SAR1802
    MSHR1132:
    SAMSHR1132_15750
    MSSA476:
    SAS1651
    Mu3:
    SAHV_1711
    Mu50:
    SAV1725
    MW2:
    MW1667
    RF122:
    SAB1583c
    ST398:
    SAPIG1777
    T0131:
    SAT0131_01828 (tagD)
    TCH60:
    HMPREF0772_11428
    TW20:
    SATW20_17150
    USA300_TCH1516:
    USA300HOU_1714
    VC40:
    SAVC_07830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIF
    N315            MKKILFDVDGIFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIF
    NCTC8325        MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIF
    Newman          MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIF
    USA300_FPR3757  MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIF
                    **********:*************************************************

    COL             QKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNIST
    N315            QKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNIST
    NCTC8325        QKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNIST
    Newman          QKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNIST
    USA300_FPR3757  QKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNIST
                    ************************************************************

    COL             NLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEV
    N315            NLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEV
    NCTC8325        NLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEV
    Newman          NLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEV
    USA300_FPR3757  NLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEV
                    ************************************************************

    COL             YQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGR
    N315            YQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGR
    NCTC8325        YQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGR
    Newman          YQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGR
    USA300_FPR3757  YQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGR
                    ************************************************************

    COL             PYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRD
    N315            PYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRD
    NCTC8325        PYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRD
    Newman          PYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRD
    USA300_FPR3757  PYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRD
                    ************************************************************

    COL             KYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHAD
    N315            KYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHAD
    NCTC8325        KYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHAD
    Newman          KYESYSNKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHAD
    USA300_FPR3757  KYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHAD
                    ***** ******************************************************

    COL             YVINHLGELRGVLDNL
    N315            YVINHLGELRGVLDNL
    NCTC8325        YVINHLGELRGVLDNL
    Newman          YVINHLGELRGVLDNL
    USA300_FPR3757  YVINHLGELRGVLDNL
                    ****************