From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004390000
  • symbol?: sgtA
  • description?: transglycosylase

      descriptions from strain specific annotations:

    • transglycosylase
    • glycosyl transferase family protein
    • transglycosylase domain-containing protein
    • Multimodular transpeptidase-transglycosylase
    • putative transglycosylase
    • pseudogene
    • Glycosyl transferase, family 51
    • penicillin-binding protein 1A
    • membrane carboxypeptidase
    • transglycosylase domain protein
    • Penicillin-binding protein
  • strand?: +
  • coordinates?: 4628904..4629809
  • synteny block?: BlockID0033940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1551 (sgtA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1688 (sgtA)
    08BA02176:
    C248_1772
    11819-97:
    MS7_1736
    71193:
    ST398NM01_1782
    ECT-R 2:
    ECTR2_1570
    ED133:
    SAOV_1716
    ED98:
    SAAV_1740
    HO 5096 0412:
    SAEMRSA15_16380
    JH1:
    SaurJH1_1820
    JH9:
    SaurJH9_1785
    JKD6008:
    SAA6008_01700 (mrcB)
    JKD6159:
    SAA6159_01653 (mrcB)
    LGA251:
    SARLGA251_16200
    M013:
    M013TW_1744
    MRSA252:
    SAR1807
    MSHR1132:
    SAMSHR1132_15800
    MSSA476:
    SAS1656
    Mu3:
    SAHV_1716 (sgtA)
    Mu50:
    SAV1730 (sgtA)
    MW2:
    MW1672 (sgtA)
    RF122:
    SAB1588
    ST398:
    SAPIG1782
    T0131:
    SAT0131_01833
    TCH60:
    HMPREF0772_11423
    TW20:
    SATW20_17200
    USA300_TCH1516:
    USA300HOU_1718 (sgtA)
    VC40:
    SAVC_07855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNQDNNHQLNHRIYHFEKIYKAIKHVIVFIFMIFIAIVAIAVIAMSLYFHHLTKTSDSL
    N315            MTNQDNNHQLNHRIYHFEKIYKAIKHVIVFIFMIFIAIVAIAVIAMSLYFHHLTKTSDSL
    NCTC8325        MTNQDNNHQLNHRIYHFEKIYKAIKHVIVFIFMIFIAIVAIAVIAMSLYFHHLTKTSDSL
    Newman          MTNQDNNHQLNHRIYHFEKIYKAIKHVIVFIFMIFIAIVAIAVIAMSLYFHHLTKTSDSL
    USA300_FPR3757  MTNQDNNHQLNHRIYHFEKIYKAIKHVIVFIFMIFIAIVAIAVIAMSLYFHHLTKTSDSL
                    ************************************************************

    COL             SDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSEDTLFY
    N315            SDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSEDTLFY
    NCTC8325        SDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSEDTLFY
    Newman          SDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSEDTLFY
    USA300_FPR3757  SDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSEDTLFY
                    ************************************************************

    COL             KHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANELRLAIRLE
    N315            KHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANELRLAIRLE
    NCTC8325        KHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANELRLAIRLE
    Newman          KHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANELRLAIRLE
    USA300_FPR3757  KHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANELRLAIRLE
                    ************************************************************

    COL             HLLSKDEIIYTYLNIVPFGKDYNGANISGIASASYSLFGIPPKDLSIAQSAYLIGLLQSP
    N315            HLLSKDEIIYTYLNIVPFGRDYNGANISGIASASYSLFGIPPKDLSIAQSAYLIGLLQSP
    NCTC8325        HLLSKDEIIYTYLNIVPFGRDYNGANISGIASASYSLFGIPPKDLSIAQSAYLIGLLQSP
    Newman          HLLSKDEIIYTYLNIVPFGRDYNGANISGIASASYSLFGIPPKDLSIAQSAYLIGLLQSP
    USA300_FPR3757  HLLSKDEIIYTYLNIVPFGRDYNGANISGIASASYSLFGIPPKDLSIAQSAYLIGLLQSP
                    *******************:****************************************

    COL             YGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALKYDIKSHLLNRKK
    N315            YGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALKYDIKSHLLNRKK
    NCTC8325        YGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALKYDIKSHLLNRKK
    Newman          YGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALKYDIKSHLLNRKK
    USA300_FPR3757  YGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALKYDIKSHLLNRKK
                    ************************************************************

    COL             R
    N315            R
    NCTC8325        R
    Newman          R
    USA300_FPR3757  R
                    *