From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004397000
  • symbol?: acsA
  • description?: acetyl-CoA synthetase

      descriptions from strain specific annotations:

    • acetyl-CoA synthetase
    • Acetyl-coenzyme A synthetase
    • acetate-CoA ligase
    • acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme) (Acetyl-CoA synthase)
  • strand?: -
  • coordinates?: 4636736..4638442
  • synteny block?: BlockID0034010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1783 (acs)
    N315:
    SA1554 (acsA)
    NCTC8325:
    Newman:
    NWMN_1626 (acs)
    USA300_FPR3757:
    04-02981:
    SA2981_1691 (acsA)
    08BA02176:
    C248_1777 (acsA)
    11819-97:
    MS7_1739
    71193:
    ST398NM01_1785
    ECT-R 2:
    ECTR2_1573
    ED133:
    SAOV_1719
    ED98:
    SAAV_1743 (acs)
    HO 5096 0412:
    SAEMRSA15_16410 (acsA)
    JH1:
    SaurJH1_1823
    JH9:
    SaurJH9_1788
    JKD6008:
    SAA6008_01703 (acsA)
    JKD6159:
    SAA6159_01656 (acsA)
    LGA251:
    SARLGA251_16230 (acsA)
    M013:
    M013TW_1747
    MRSA252:
    SAR1811 (acsA)
    MSHR1132:
    SAMSHR1132_15830
    MSSA476:
    SAS1659
    Mu3:
    SAHV_1719 (acsA)
    Mu50:
    SAV1733 (acsA)
    MW2:
    MW1676 (acsA)
    RF122:
    SAB1593c (acsA)
    ST398:
    SAPIG1785
    T0131:
    SAT0131_01837
    TCH60:
    HMPREF0772_11420 (acs)
    TW20:
    SATW20_17230 (acsA)
    USA300_TCH1516:
    USA300HOU_1722 (acsA1)
    VC40:
    SAVC_07875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
    N315            MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
    NCTC8325        MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
    Newman          MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
    USA300_FPR3757  MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
                    ************************************************************

    COL             IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
    N315            IALNYKDEYRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
    NCTC8325        IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
    Newman          IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
    USA300_FPR3757  IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
                    ********:***************************************************

    COL             KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
    N315            KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
    NCTC8325        KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
    Newman          KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
    USA300_FPR3757  KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
                    ************************************************************

    COL             NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTRQPKGVLHVQQAMLVHYISGKYVL
    N315            NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
    NCTC8325        NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
    Newman          NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
    USA300_FPR3757  NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
                    ************************************ ***********************

    COL             DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
    N315            DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
    NCTC8325        DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
    Newman          DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
    USA300_FPR3757  DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
                    ************************************************************

    COL             APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
    N315            APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
    NCTC8325        APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
    Newman          APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
    USA300_FPR3757  APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
                    ************************************************************

    COL             GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
    N315            GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
    NCTC8325        GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
    Newman          GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
    USA300_FPR3757  GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
                    ************************************************************

    COL             PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
    N315            PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
    NCTC8325        PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
    Newman          PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
    USA300_FPR3757  PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
                    ************************************************************

    COL             EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRIFVKEGLSAHAAPREIEFKDKLP
    N315            EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
    NCTC8325        EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRIFVKEGLSAHAAPREIEFKDKLP
    Newman          EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRIFVKEGLSAHAAPREIEFKDKLP
    USA300_FPR3757  EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRIFVKEGLSAHAAPREIEFKDKLP
                    *************************************:**********************

    COL             KTRSGKIMRRVLKAWELNLDAGDLSTME
    N315            KTRSGKIMRRVLKAWELNLDAGDLSTME
    NCTC8325        KTRSGKIMRRVLKAWELNLDAGDLSTME
    Newman          KTRSGKIMRRVLKAWELNLDAGDLSTME
    USA300_FPR3757  KTRSGKIMRRVLKAWELNLDAGDLSTME
                    ****************************