Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004400000
  • symbol?: ccpA
  • description?: catabolite control protein A

      descriptions from strain specific annotations:

    • catabolite control protein A
    • global transcriptional regulator, catabolite control protein A
  • strand?: -
  • coordinates?: 4640540..4641484
  • synteny block?: BlockID0034040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1786 (ccpA)
    N315:
    SA1557 (ccpA)
    NCTC8325:
    Newman:
    NWMN_1629 (ccpA)
    USA300_FPR3757:
    04-02981:
    SA2981_1694 (ccpA)
    08BA02176:
    C248_1780 (ccpA)
    11819-97:
    MS7_1742 (ccpA)
    71193:
    ST398NM01_1788
    ECT-R 2:
    ECTR2_1576 (ccpA)
    ED133:
    SAOV_1722 (ccpA)
    ED98:
    SAAV_1746 (ccpA)
    HO 5096 0412:
    SAEMRSA15_16440 (ccpA)
    JH1:
    SaurJH1_1826
    JH9:
    SaurJH9_1791
    JKD6008:
    SAA6008_01706 (ccpA)
    JKD6159:
    SAA6159_01659 (ccpA)
    LGA251:
    SARLGA251_16260 (ccpA)
    M013:
    M013TW_1750
    MRSA252:
    SAR1814 (ccpA)
    MSHR1132:
    SAMSHR1132_15860
    MSSA476:
    SAS1662
    Mu3:
    SAHV_1722 (ccpA)
    Mu50:
    SAV1736 (ccpA)
    MW2:
    MW1679 (ccpA)
    RF122:
    SAB1596c (ccpA)
    ST398:
    SAPIG1788 (ccpA)
    T0131:
    SAT0131_01841
    TCH60:
    HMPREF0772_11417 (ccpA)
    TW20:
    SATW20_17260 (ccpA)
    USA300_TCH1516:
    USA300HOU_1725 (ccpA)
    VC40:
    SAVC_07890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVTIYDVAREARVSMATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKT
    N315            ---------------MATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKT
    NCTC8325        MTVTIYDVAREARVSMATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKT
    Newman          MTVTIYDVAREARVSMATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKT
    USA300_FPR3757  MTVTIYDVAREARVSMATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKT
                                   *********************************************

    COL             TTVGVIIPDISNIYYSQLARGLEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGI
    N315            TTVGVIIPDISNIYYSQLARGLEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGI
    NCTC8325        TTVGVIIPDISNIYYSQLARGLEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGI
    Newman          TTVGVIIPDISNIYYSQLARGLEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGI
    USA300_FPR3757  TTVGVIIPDISNIYYSQLARGLEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGI
                    ************************************************************

    COL             IFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDFTEAAKEITGELIEKGAKSF
    N315            IFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDFTEAAKEITGELIEKGAKSF
    NCTC8325        IFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDFTEAAKEITGELIEKGAKSF
    Newman          IFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDFTEAAKEITGELIEKGAKSF
    USA300_FPR3757  IFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDFTEAAKEITGELIEKGAKSF
                    ************************************************************

    COL             ALVGGEHSKKAQEDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLPDAI
    N315            ALVGGEHSKKAQEDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLPDAI
    NCTC8325        ALVGGEHSKKAQEDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLPDAI
    Newman          ALVGGEHSKKAQEDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLPDAI
    USA300_FPR3757  ALVGGEHSKKAQEDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLPDAI
                    ************************************************************

    COL             LCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMR
    N315            LCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMR
    NCTC8325        LCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMR
    Newman          LCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMR
    USA300_FPR3757  LCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMR
                    ************************************************************

    COL             LLTKYMNDEKIEEPNVVLPHRIEYRGTTK
    N315            LLTKYMNDEKIEEPNVVLPHRIEYRGTTK
    NCTC8325        LLTKYMNDEKIEEPNVVLPHRIEYRGTTK
    Newman          LLTKYMNDEKIEEPNVVLPHRIEYRGTTK
    USA300_FPR3757  LLTKYMNDEKIEEPNVVLPHRIEYRGTTK
                    *****************************