From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004426000
  • symbol?:
  • description?: putative choline kinase involved in lipopolysaccharide biosynthesis

      descriptions from strain specific annotations:

    • putative choline kinase involved in lipopolysaccharide biosynthesis
    • phosphotransferase family protein
    • phosphotransferase enzyme family protein
    • kanamycin kinase
    • aminoglycoside phosphotransferase family protein
  • strand?: -
  • coordinates?: 4673162..4673887
  • synteny block?: BlockID0034240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1707
    08BA02176:
    C248_1795
    11819-97:
    MS7_1755
    71193:
    ST398NM01_1802
    ECT-R 2:
    ECTR2_1589
    ED133:
    SAOV_1735
    ED98:
    SAAV_1759
    HO 5096 0412:
    SAEMRSA15_16570
    JH1:
    SaurJH1_1839
    JH9:
    SaurJH9_1804
    JKD6008:
    SAA6008_01721
    JKD6159:
    SAA6159_01672
    LGA251:
    SARLGA251_16390
    M013:
    M013TW_1764
    MRSA252:
    SAR1834
    MSHR1132:
    SAMSHR1132_15990
    MSSA476:
    SAS1675
    Mu3:
    SAHV_1735
    Mu50:
    SAV1749
    MW2:
    MW1692
    RF122:
    SAB1609c
    ST398:
    SAPIG1802
    T0131:
    SAT0131_01858 (vraG)
    TCH60:
    HMPREF0772_11403
    TW20:
    SATW20_17390
    USA300_TCH1516:
    USA300HOU_1739
    VC40:
    SAVC_07955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQFYQLGWTLDSAGGASGEAYMAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIE
    N315            MEQFYQLGWTLDSAGGASGEAYMAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIE
    NCTC8325        ----------------------MAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIE
    Newman          MEQFYQLGWTLDSAGGASGEAYMAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIE
    USA300_FPR3757  ----------------------MAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIE
                                          **************************************

    COL             TGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKI
    N315            TGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKI
    NCTC8325        TGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKI
    Newman          TGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKI
    USA300_FPR3757  TGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKI
                    ************************************************************

    COL             NASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEG
    N315            NASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEG
    NCTC8325        NASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEG
    Newman          NASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEG
    USA300_FPR3757  NASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEG
                    ************************************************************

    COL             AMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQ
    N315            AMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQ
    NCTC8325        AMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQ
    Newman          AMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQ
    USA300_FPR3757  AMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQ
                    ************************************************************

    COL             KRYKDMNTWLKFLNEVMNSNMFI
    N315            KRYKDMNTWLKFLNEVMNSNMFI
    NCTC8325        KRYKDMNTWLKFLNEVMNSNMFI
    Newman          KRYKDMNTWLKFLNEVMNSNMFI
    USA300_FPR3757  KRYKDMNTWLKFLNEVMNSNMFI
                    ***********************