From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004430000
  • symbol?:
  • description?: YtxH domain-containing protein
  • strand?: -
  • coordinates?: 4677981..4678403
  • synteny block?: BlockID0034280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1710
    08BA02176:
    C248_1799
    11819-97:
    MS7_1758
    71193:
    ST398NM01_1805
    ECT-R 2:
    ECTR2_1592
    ED133:
    SAOV_1738
    ED98:
    SAAV_1762
    HO 5096 0412:
    SAEMRSA15_16600
    JH1:
    SaurJH1_1842
    JH9:
    SaurJH9_1807
    JKD6008:
    SAA6008_01724
    JKD6159:
    SAA6159_01675
    LGA251:
    SARLGA251_16420
    M013:
    M013TW_1767
    MRSA252:
    SAR1837
    MSHR1132:
    SAMSHR1132_16020
    MSSA476:
    SAS1678
    Mu3:
    SAHV_1738
    Mu50:
    SAV1752
    MW2:
    MW1695
    RF122:
    SAB1612c
    ST398:
    SAPIG1805
    T0131:
    SAT0131_01861
    TCH60:
    HMPREF0772_11400
    TW20:
    SATW20_17420
    USA300_TCH1516:
    USA300HOU_1743
    VC40:
    SAVC_07970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIA
    N315            MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIA
    NCTC8325        MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIA
    Newman          MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIA
    USA300_FPR3757  MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIA
                    ************************************************************

    COL             NETIKEVKTNPKEYANRLKNNPKAFFKEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNN
    N315            NETIKEVKTNPKEYANRLKNNPKAFFEEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNN
    NCTC8325        NETIKEVKTNPKEYANRLKNNPKAFFKEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNN
    Newman          NETIKEVKTNPKEYANRLKNNPKAFFKEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNN
    USA300_FPR3757  NETIKEVKTNPKEYANRLKNNPKAFFKEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNN
                    **************************:*********************************

    COL             LRIVTEEDLKKNKNALSDKE
    N315            LRIVTEEDLKKNKNALSDKE
    NCTC8325        LRIVTEEDLKKNKNALSDKE
    Newman          LRIVTEEDLKKNKNALSDKE
    USA300_FPR3757  LRIVTEEDLKKNKNALSDKE
                    ********************