From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004464000
  • symbol?: arsB
  • description?: arsenical efflux pump membrane protein ArsB

      descriptions from strain specific annotations:

    • arsenical efflux pump membrane protein ArsB
    • aresenical pump membrane protein
    • arsenical pump membrane protein
    • Ars family arsenical pump
    • Arsenic efflux pump protein
    • aesenical pump membrane protein
    • ArsB arsenite-antimonite efflux family transporter membrane protein
    • arsenical pump membrane family protein
    • arsenical pump membrane protein (Arsenic efflux pump protein)
    • arsenical pump membrane protein 2
    • arsenic efflux pump protein ArsB
  • strand?: +
  • coordinates?: 4709194..4710492
  • synteny block?: BlockID0034610
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1823 (arsB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1729
    08BA02176:
    C248_1819 (arsB2)
    11819-97:
    MS7_1776 (arsB)
    71193:
    ST398NM01_1824
    ECT-R 2:
    ECTR2_1610 (arsB)
    ED133:
    SAOV_1757 (arsB)
    ED98:
    SAAV_1784 (arsB)
    HO 5096 0412:
    SAEMRSA15_16800 (arsB2)
    JH1:
    SaurJH1_1861
    JH9:
    SaurJH9_1826
    JKD6008:
    SAA6008_01745 (arsB)
    JKD6159:
    LGA251:
    SARLGA251_16600 (arsB2)
    M013:
    M013TW_1786
    MRSA252:
    SAR1856 (arsB2)
    MSHR1132:
    SAMSHR1132_16210
    MSSA476:
    SAS1697
    Mu3:
    SAHV_1759
    Mu50:
    SAV1774
    MW2:
    MW1714
    RF122:
    SAB1631 (arsB)
    ST398:
    SAPIG1824
    T0131:
    SAT0131_01888
    TCH60:
    HMPREF0772_11381 (arsB)
    TW20:
    SATW20_17630 (arsB2)
    USA300_TCH1516:
    USA300HOU_1763 (arsB)
    VC40:
    SAVC_08080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMTTLATLIFLVTLLFVLWQPKGLDIGITALTGAFIAVITGVVSFSDVFEVTGIVWNATL
    N315            MMTTLATLIFLVTLLFVLWQPKGLDIGITALTGAFIAVITGVVSFSDVFEVTGIVWNATL
    NCTC8325        MMTTLATLIFLVTLLFVLWQPKGLDIGITALTGAFIAVITGVVSFSDVFEVTGIVWNATL
    Newman          MMTTLATLIFLVTLLFVLWQPKGLDIGITALTGAFIAVITGVVSFSDVFEVTGIVWNATL
    USA300_FPR3757  MMTTLATLIFLVTLLFVLWQPKGLDIGITALTGAFIAVITGVVSFSDVFEVTGIVWNATL
                    ************************************************************

    COL             TFVSVILISLILDKVGLFEWSAIHMLHASKGNGLKMFVYIILLGAIVAAFFANDGAALIL
    N315            TFVSVILISLILDKVGLFEWSAIHMLHASKGNGLKMFVYIILLGAIVAAFFANDGAALIL
    NCTC8325        TFVSVILISLILDKVGLFEWSAIHMLHASKGNGLKMFVYIILLGAIVAAFFANDGAALIL
    Newman          TFVSVILISLILDKVGLFEWSAIHMLHASKGNGLKMFVYIILLGAIVAAFFANDGAALIL
    USA300_FPR3757  TFVSVILISLILDKVGLFEWSAIHMLHASKGNGLKMFVYIILLGAIVAAFFANDGAALIL
                    ************************************************************

    COL             TPIVLAMVKNIGFSKRAIFPFIIASGFIADTTSLPLIVSNLVNIISADYFHVGFVRYFSR
    N315            TPIVLAMVKNIGFSKRAIFPFIIASGFIADTTSLPLIVSNLVNIISADYFHVGFVRYFSR
    NCTC8325        TPIVLAMVKNIGFSKRAIFPFIIASGFIADTTSLPLIVSNLVNIISADYFHVGFVRYFSR
    Newman          TPIVLAMVKNIGFSKRAIFPFIIASGFIADTTSLPLIVSNLVNIISADYFHVGFVRYFSR
    USA300_FPR3757  TPIVLAMVKNIGFSKRAIFPFIIASGFIADTTSLPLIVSNLVNIISADYFHVGFVRYFSR
                    ************************************************************

    COL             MIIPNLFSLLASIIVLWLYFRKAIPKTFDDNNIKHPKDAINDLKLFKISWIVLVILLFGY
    N315            MIIPNLFSLLASIIVLWLYFRKAIPKTFDDNNIKHPKDAINDLKLFKISWIVLVILLFGY
    NCTC8325        MIIPNLFSLLASIIVLWLYFRKAIPKTFDDNNIKHPKDAINDLKLFKISWIVLVILLFGY
    Newman          MIIPNLFSLLASIIVLWLYFRKAIPKTFDDNNIKHPKDAINDLKLFKISWIVLVILLFGY
    USA300_FPR3757  MIIPNLFSLLASIIVLWLYFRKAIPKTFDDNNIKHPKDAINDLKLFKISWIVLVILLFGY
                    ************************************************************

    COL             LISEFTKIPVSIFTGIIAFIFLMLARKSNAVNIKQVIKGAPWNIVLFSIGMYIVVFGLRN
    N315            LISEFTKIPVSIFTGIIAFIFLMLARKSNAVNIKQVIKGAPWNIVLFSIGMYIVVFGLRN
    NCTC8325        LISKFTKIPVSIFTGIIAFIFLMLARKSNAVNIKQVIKGAPWNIVLFSIGMYIVVFGLRN
    Newman          LISEFTKIPVSIFTGIIAFIFLMLARKSNAVNIKQVIKGAPWNIVLFSIGMYIVVFGLRN
    USA300_FPR3757  LISEFTKIPVSIFTGIIAFIFLMLARKSNAVNIKQVIKGAPWNIVLFSIGMYIVVFGLRN
                    ***:********************************************************

    COL             AGITLILAKILEYISNYGLFSTILGMGFISAFLSSIMNNMPTVLIDAIAIGQSNVHGMLK
    N315            AGITLILAKILEYISNYGLFSTILGMGFISAFLSSIMNNMPTVLIDAIAIGQSNVHGMLK
    NCTC8325        AGITLILAKILEYISNYGLFSTILGMGFISAFLSSIMNNMPTVLIDAIAIGQSNVHGMLK
    Newman          AGITLILAKILEYISNYGLFSTILGMGFISAFLSSIMNNMPTVLIDAIAIGQSNVHGMLK
    USA300_FPR3757  AGITLILAKILEYISNYGLFSTILGMGFISAFLSSIMNNMPTVLIDAIAIGQSNVHGMLK
                    ************************************************************

    COL             EGLIYANVIGSDLGPKITPIGSLATLLWLHVLTQKDVKISWGTYFKTGIIITIPVLFITL
    N315            EGLIYANVIGSDLGPKITPIGSLATLLWLHVLTQKDVKISWGTYFKTGIIITIPVLFITL
    NCTC8325        EGLIYANVIGSDLGPKITPIGSLATLLWLHVLTQKDVKISWGTYFKTGIIITIPVLFITL
    Newman          EGLIYANVIGSDLGPKITPIGSLATLLWLHVLTQKDVKISWGTYFKTGIIITIPVLFITL
    USA300_FPR3757  EGLIYANVIGSDLGPKITPIGSLATLLWLHVLTQKDVKISWGTYFKTGIIITIPVLFITL
                    ************************************************************

    COL             IGLYLTLIIF
    N315            IGLYLTLIIF
    NCTC8325        IGLYLTLIIF
    Newman          IGLYLTLIIF
    USA300_FPR3757  IGLYLTLIIF
                    **********