From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004467000
  • symbol?:
  • description?: autolysin

      descriptions from strain specific annotations:

    • autolysin
    • N-acetylmuramoyl-L-alanine amidase
    • mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
    • exported protein
    • family 4 N-acetylmuramoyl-L-alanine amidase
    • mannosyl-glycoendo-beta-N-acetylglucosaminidase family protein
    • mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
    • mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase family protein
    • mannosyl-glycoprotein endo-beta-N-glucosaminidase
    • peptidoglycan endo-beta-N-acetylglucosaminidase
  • strand?: -
  • coordinates?: 4713518..4714376
  • synteny block?: BlockID0034630
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1730
    08BA02176:
    C248_1820
    11819-97:
    MS7_1777
    71193:
    ST398NM01_1825
    ECT-R 2:
    ECTR2_1611
    ED133:
    SAOV_1759
    ED98:
    SAAV_1785
    HO 5096 0412:
    SAEMRSA15_16840
    JH1:
    SaurJH1_1862
    JH9:
    SaurJH9_1827
    JKD6008:
    SAA6008_01747
    JKD6159:
    SAA6159_01696
    LGA251:
    SARLGA251_16620
    M013:
    M013TW_1788
    MRSA252:
    SAR1857
    MSHR1132:
    SAMSHR1132_16220
    MSSA476:
    SAS1698
    Mu3:
    SAHV_1760
    Mu50:
    SAV1775
    MW2:
    MW1715
    RF122:
    SAB1633c
    ST398:
    SAPIG1825
    T0131:
    SAT0131_01890
    TCH60:
    HMPREF0772_11380
    TW20:
    SATW20_17650
    USA300_TCH1516:
    USA300HOU_1765
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKHKKGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDAAKKQI
    N315            MNKHKKGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDAAKKQI
    NCTC8325        MNKHKKGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDAAKKQI
    Newman          MNKHKKGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDAAKKQI
    USA300_FPR3757  MNKHKKGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDAAKKQI
                    ************************************************************

    COL             NNYTSQQVSNKKNDAWRDASATEIKSAMDSGTFIDNEKQKYQFLDLSKYQGIDKNRIKRM
    N315            NNYTSQQVSNKKNDAWRDASATEIKSAMDSGTFIDNEKQKYQFLDLSKYQGIDKNRIKRM
    NCTC8325        NNYTSQQVSNKKNDAWRDASATEIKSAMDSGTFIDNEKQKYQFLDLSKYQGIDKNRIKRM
    Newman          NNYTSQQVSNKKNDAWRDASATEIKSAMDSGTFIDNEKQKYQFLDLSKYQGIDKNRIKRM
    USA300_FPR3757  NNYTSQQVSNKKNDAWRDASATEIKSAMDSGTFIDNEKQKYQFLDLSKYQGIDKNRIKRM
                    ************************************************************

    COL             LVDRPTLLKHTDDFLKAAKDKHVNEVYLISHALLETGAVKSELANGVEIDGKKYYNFYGV
    N315            LVDRPTLLKHTDDFLKAAKDKHVNEVYLISHALLETGAVKSELANGVEIDGKKYYNFYGV
    NCTC8325        LVDRPTLLKHTDDFLKAAKDKHVNEVYLISHALLETGAVKSELANGVEIDGKKYYNFYGV
    Newman          LVDRPTLLKHTDDFLKAAKDKHVNEVYLISHALLETGAVKSELANGVEIDGKKYYNFYGV
    USA300_FPR3757  LVDRPTLLKHTDDFLKAAKDKHVNEVYLISHALLETGAVKSELANGVEIDGKKYYNFYGV
                    ************************************************************

    COL             GALDKDPIKTGAEYAKKHGWDTPEKAISGGADFIHKHFLSSTDQNTLYSMRWNPKNPGEH
    N315            GALDKDPIKTGAEYAKKHGWDTPEKAISGGADFIHKHFLSSTDQNTLYSMRWNPKNPGEH
    NCTC8325        GALDKDPIKTGAEYAKKHGWDTPEKAISGGADFIHKHFLSSTDQNTLYSMRWNPKNPGEH
    Newman          GALDKDPIKTGAEYAKKHGWDTPEKAISGGADFIHKHFLSSTDQNTLYSMRWNPKNPGEH
    USA300_FPR3757  GALDKDPIKTGAEYAKKHGWDTPEKAISGGADFIHKHFLSSTDQNTLYSMRWNPKNPGEH
                    ************************************************************

    COL             QYATDIKWAESNATIIADFYKNMKTEGKYFKYFVYKDDSKHLNK
    N315            QYATDIKWAESNATIIADFYKNMKTEGKYFKYFVYKDDSKHLNK
    NCTC8325        QYATDIKWAESNATIIADFYKNMKTEGKYFKYFVYKDDSKHLNK
    Newman          QYATDIKWAESNATIIADFYKNMKTEGKYFKYFVYKDDSKHLNK
    USA300_FPR3757  QYATDIKWAESNATIIADFYKNMKTEGKYFKYFVYKDDSKHLNK
                    ********************************************