From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004473000
  • symbol?: comK2
  • description?: competence protein ComK

      descriptions from strain specific annotations:

    • competence protein ComK
    • comK family protein
  • strand?: +
  • coordinates?: 4716065..4716676
  • synteny block?: BlockID0034690
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1733
    08BA02176:
    C248_1823
    11819-97:
    MS7_1780
    71193:
    ST398NM01_1829
    ECT-R 2:
    ECTR2_1615
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_16870
    JH1:
    SaurJH1_1865
    JH9:
    SaurJH9_1830
    JKD6008:
    JKD6159:
    SAA6159_01699
    LGA251:
    SARLGA251_16650
    M013:
    M013TW_1790
    MRSA252:
    SAR1860
    MSHR1132:
    SAMSHR1132_16250
    MSSA476:
    SAS1701
    Mu3:
    SAHV_1763
    Mu50:
    SAV1778
    MW2:
    MW1718
    RF122:
    SAB1636
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11376
    TW20:
    SATW20_17680
    USA300_TCH1516:
    USA300HOU_1767
    VC40:
    SAVC_08105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQDNSTKYLLYIQTATSNHLETNCVFLHCDYILKVPINKLVSYYAKLHLSSQSVLIETAK
    N315            MQDNSTKYLLYIQTATSNHLETNCVFLHCDYILKVPINKLVSYYAKLHLSSQSVLIETAK
    NCTC8325        MQDNSTKYLLYIQTATSNHLETNCVFLHCDYILKVPINKLVSYYAKLHLSSQSVLIETAK
    Newman          MQDNSTKYLLYIQTATSNHLETNCVFLHCDYILKVPINKLVSYYAKLHLSSQSVLIETAK
                    ************************************************************

    COL             NILNINKLVPIYINPKTILFPLKHKRAPIQIYINAHYIVGMTAIENSTLIHFQEGIQLEV
    N315            NILNINKLVPIYINPKTILFPLKHKRAPIQIYINAHYIVGMTAIENSTLIHFQEGIQLEV
    NCTC8325        NILNINKLVPIYINPKTILFPLKHKRAPIQIYINAHYIVGMTAIENSTLIHFQEGIQLEV
    Newman          NILNINKLVPIYINPKTILFPLKHKRAPIQIYINAHYIVGMTAIENSTLIHFQEGIQLEV
                    ************************************************************

    COL             DEPFSLVSKKCHESLALKHFIENTISN
    N315            DEPFSLVSKKCHESLALKHFIENTISN
    NCTC8325        DEPFSLVSKKCHESLALKHFIENTISN
    Newman          DEPFSLVSKKCHESLALKHFIENTISN
                    ***************************