From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004476000
  • symbol?: spdA
  • description?: abortive infection protein

      descriptions from strain specific annotations:

    • abortive infection protein
    • CAAX amino terminal protease family
    • CAAX amino terminal protease family protein
    • pseudogene
    • CAAX amino terminal protease self- immunity family protein
    • caax amino protease family protein
    • membrane spanning protein
  • strand?: +
  • coordinates?: 4717312..4718547
  • synteny block?: BlockID0034720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1735
    08BA02176:
    C248_1825
    11819-97:
    MS7_1782
    71193:
    ST398NM01_1830
    ECT-R 2:
    ECTR2_1616
    ED133:
    SAOV_1764
    ED98:
    SAAV_1790
    HO 5096 0412:
    SAEMRSA15_16890
    JH1:
    SaurJH1_1867
    JH9:
    SaurJH9_1832
    JKD6008:
    SAA6008_01750
    JKD6159:
    SAA6159_01701
    LGA251:
    SARLGA251_16670
    M013:
    M013TW_1792
    MRSA252:
    SAR1862
    MSHR1132:
    SAMSHR1132_16270
    MSSA476:
    SAS1703
    Mu3:
    SAHV_1765
    Mu50:
    SAV1780
    MW2:
    MW1720
    RF122:
    SAB1638
    ST398:
    SAPIG1830
    T0131:
    SAT0131_01895
    TCH60:
    HMPREF0772_11374
    TW20:
    SATW20_17700
    USA300_TCH1516:
    USA300HOU_1769
    VC40:
    SAVC_08115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQKFKDFFYDDLSVTRGNYFLTLMAAFFITIILFIGIVVSEVHLLYSMLIVLVGLILLRL
    N315            MQKFKDFFYDDLSVTRGNYFLTLMAAFFITIILFIGIVVSEVHLLYSMLIVLVGLILLRL
    NCTC8325        MQKFKDFFYDDLSVTRGNYFLTLMAAFFITIILFIGIVVSEVHLLYSMLIVLVGLILLRL
    Newman          MQKFKDFFYDDLSVTRGNYFLTLMAAFFITIILFIGIVVSEVHLLYSMLIVLVGLILLRL
    USA300_FPR3757  MQKFKDFFYDDLSVTRGNYFLTLMAAFFITIILFIGIVVSEVHLLYSMLIVLVGLILLRL
                    ************************************************************

    COL             FKINLFSFKKLTLSQVIYIIGGALLIYGLDNLYLYFHDVPANEQQLEQAIRNTPFYISIF
    N315            FKINLFSFKKLTLSQVIYIIGGALLIYGLDNLYLYFHDVPANELQLEQEIRNTPFYISIF
    NCTC8325        FKINLFSFKKLTLSQVIYIIGGALLIYGLDNLYLYFHDVPANEQQLEQAIRNTPFYISIF
    Newman          FKINLFSFKKLTLSQVIYIIGGALLIYGLDNLYLYFHDVPANEQQLEQAIRNTPFYISIF
    USA300_FPR3757  FKINLFSFKKLTLSQVIYIIGGALLIYGLDNLYLYFHDVPANEQQLEQAIRNTPFYISIF
                    ******************************************* **** ***********

    COL             TVTIIPAIVEEIVFRGMIIRVIFRKHLFLGLIVSSLVFASLHESDTWIGYLPYLYSGLIF
    N315            TVTIIPAIVEEIVFRGMIIRVIFRKHLFLGLLVSSLVFASLHESDTWIGYLPYLYSGLIF
    NCTC8325        TVTIIPAIVEEIVFRGMIIRVIFRKHLFLGLIVSSLVFASLHESDTWIGYLPYLYSGLIF
    Newman          TVTIIPAIVEEIVFRGMIIRVIFRKHLFLGLIVSSLVFASLHESDTWIGYLPYLYSGLIF
    USA300_FPR3757  TVTIIPAIVEEIVFRGMIIRVIFRKHLFLGLIVSSLVFASLHESDTWIGYLPYLYSGLIF
                    *******************************:****************************

    COL             GLIYIKTKRLEVVIFMHFLNNLLALLFIIWR
    N315            GLIYIKTKRLEVVIFMHFLNNLLALLFIIWG
    NCTC8325        GLIYIKTKRLEVVIFMHFLNNLLALLFIIWR
    Newman          GLIYIKTKRLEVVIFMHFLNNLLALLFIIWR
    USA300_FPR3757  GLIYIKTKRLEVVIFMHFLNNLLALLFIIWR
                    ******************************