From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004483000
  • symbol?: crcB2
  • description?: camphor resistance CrcB protein

      descriptions from strain specific annotations:

    • camphor resistance CrcB protein
    • crcB family protein
    • Protein crcB 2
    • protein crcB
    • putative Protein CrcB homolog 2
    • CrcB-like protein
    • camphor resistance protein
    • camphor resistance protein CrcB_1
    • Protein CrcB -like protein 2
    • crcB-like family protein
    • protein crcB-like protein
    • membrane protein
  • strand?: +
  • coordinates?: 4722293..4722682
  • synteny block?: BlockID0034790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1739
    08BA02176:
    C248_1831
    11819-97:
    MS7_1786
    71193:
    ST398NM01_1835
    ECT-R 2:
    ECTR2_1620
    ED133:
    SAOV_1768
    ED98:
    SAAV_1794
    HO 5096 0412:
    SAEMRSA15_16940
    JH1:
    SaurJH1_1871
    JH9:
    SaurJH9_1836
    JKD6008:
    SAA6008_01754 (crcB_1)
    JKD6159:
    SAA6159_01705 (crcB_1)
    LGA251:
    SARLGA251_16710
    M013:
    M013TW_1797
    MRSA252:
    SAR1867
    MSHR1132:
    SAMSHR1132_16320
    MSSA476:
    SAS1707
    Mu3:
    SAHV_1769
    Mu50:
    SAV1784
    MW2:
    MW1724
    RF122:
    SAB1642
    ST398:
    SAPIG1835
    T0131:
    SAT0131_01899
    TCH60:
    HMPREF0772_11369
    TW20:
    SATW20_17740
    USA300_TCH1516:
    USA300HOU_1773
    VC40:
    SAVC_08135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISTSW
    N315            MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW
    NCTC8325        MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW
    Newman          MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW
    USA300_FPR3757  MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW
                    ********************************************************* **

    COL             FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
    N315            FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFDINLFLNYSLLQFIIGFIACYIGYHI
    NCTC8325        FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
    Newman          FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
    USA300_FPR3757  FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
                    *******************************:*************************