From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004500000
  • symbol?:
  • description?: exported protein
  • strand?: -
  • coordinates?: 4732058..4732966
  • synteny block?: BlockID0034910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1744
    08BA02176:
    C248_1833
    11819-97:
    MS7_1788
    71193:
    ST398NM01_1837
    ECT-R 2:
    ECTR2_1624
    ED133:
    SAOV_1770
    ED98:
    SAAV_1798
    HO 5096 0412:
    SAEMRSA15_16970
    JH1:
    SaurJH1_1876
    JH9:
    SaurJH9_1840
    JKD6008:
    SAA6008_01764
    JKD6159:
    SAA6159_01707
    LGA251:
    SARLGA251_16730
    M013:
    M013TW_1799
    MRSA252:
    SAR1869
    MSHR1132:
    SAMSHR1132_16340
    MSSA476:
    SAS1710
    Mu3:
    SAHV_1774
    Mu50:
    SAV1789
    MW2:
    MW1727
    RF122:
    SAB1644c
    ST398:
    SAPIG1837
    T0131:
    SAT0131_01903
    TCH60:
    HMPREF0772_11367
    TW20:
    SATW20_17780
    USA300_TCH1516:
    USA300HOU_1776
    VC40:
    SAVC_08155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MDLSSPIVIGLIIAVVIALIFFVLFLVALGSKKKVKRQTEEKYEQQEQNIKKSHEEALE
    N315            MMDLSSPVVIGLIIAVVIALIFFVLFLVALGSKKKVKRQTEEKYEQQEQNIKKSHEEALE
    NCTC8325        -MDLSSPIVIGLIIAVVIALIFFVLFLVALGSKKKVKRQTEEKYEQQEQNIKKSHEEALE
    Newman          -MDLSSPIVIGLIIAVVIALIFFVLFLVALGSKKKVKRQTEEKYEQQEQNIKKSHEEALE
    USA300_FPR3757  -MDLSSPIVIGLIIAVVIALIFFVLFLVALGSKKKVKRQTEEKYEQQEQNIKKSHEEALE
                     ******:****************************************************

    COL             KERIQNKKTITKQQEDYNHMVSTKDREIDALKLFSKNHSEYVTDMRLIGIRERLVKEKRI
    N315            KERIQNKKTITKQQEDYNHMVSTKDREIDALKLFSKNHSEYVTDMRLIGIRERLVKEKRI
    NCTC8325        KERIQNKKTITKQQEDYNHMVSTKDREIDALKLFSKNHSEYVTDMRLIGIRERLVKEKRI
    Newman          KERIQNKKTITKQQEDYNHMVSTKDREIDALKLFSKNHSEYVTDMRLIGIRERLVKEKRI
    USA300_FPR3757  KERIQNKKTITKQQEDYNHMVSTKDREIDALKLFSKNHSEYVTDMRLIGIRERLVKEKRI
                    ************************************************************

    COL             RPEDMHIMANIFLPKDGFNNIERISHLVLTRTGLYIIDSQLLKGHVYNGISGGQFKDLPP
    N315            RPEDMHIMANIFLPKDGFNNIERISHLVLTRTGLYIIDSQLLKGHVYNGISGGQFKDLPP
    NCTC8325        RPEDMHIMANIFLPKDGFNNIERISHLVLTRTGLYIIDSQLLKGHVYNGISGGQFKDLPP
    Newman          RPEDMHIMANIFLPKDGFNNIERISHLVLTRTGLYIIDSQLLKGHVYNGISGGQFKDLPP
    USA300_FPR3757  RPEDMHIMANIFLPKDGFNNIERISHLVLTRTGLYIIDSQLLKGHVYNGISGGQFKDLPP
                    ************************************************************

    COL             MEQVFDTLDLDKSRPQTIVMDQNDDKRSLSFVNYSDQIEAIKQLAEDLQKELGAKYTPTS
    N315            MEQVFDTLDLDKSRPQTIVMDQNDDKRSLSFVNYSDQIEAIKQLAEDLQKELGAKYTPTS
    NCTC8325        MEQVFDTLDLDKSRPQTIVMDQNDDKRSLSFVNYSDQIEAIKQLAEDLQKELGAKYTPTS
    Newman          MEQVFDTLDLDKSRPQTIVMDQNDDKRSLSFVNYSDQIEAIKQLAEDLQKELGAKYTPTS
    USA300_FPR3757  MEQVFDTLDLDKSRPQTIVMDQNDDKRSLSFVNYSDQIEAIKQLAEDLQKELGAKYTPTS
                    ************************************************************

    COL             ILYFNLKNEGDVTISNYNQNSAVKVLVGAEQLDEFFNKFVFHGRIQYNVEDLQQMMDKIE
    N315            ILYFNPKNEGDVTISNYNQNSAVKVLVGAEQLDEFFNKFVFHGRIQYNVEDLQQMMDKIE
    NCTC8325        ILYFNLKNEGDVTISNYNQNSAVKVLVGAEQLDEFFNKFVFHGRIQYNVEDLQQMMDKIE
    Newman          ILYFNLKNEGDVTISNYNQNSAVKVLVGAEQLDEFFNKFVFHGRIQYNVEDLQQMMDKIE
    USA300_FPR3757  ILYFNLKNEGDVTISNYNQNSAVKVLVGAEQLDEFFNKFVFHGRIQYNVEDLQQMMDKIE
                    ***** ******************************************************

    COL             SFN
    N315            SFN
    NCTC8325        SFN
    Newman          SFN
    USA300_FPR3757  SFN
                    ***