From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004511000
  • symbol?: menE
  • description?: 2-succinylbenzoate-CoA ligase

      descriptions from strain specific annotations:

    • 2-succinylbenzoate-CoA ligase
    • O-succinylbenzoic acid--CoA ligase
    • O-succinylbenzoate-CoA ligase
    • acyl-CoA synthetase
    • AMP-binding protein
    • O-succinylbenzoic acid--CoA ligase, putative
  • strand?: -
  • coordinates?: 4739953..4741431
  • synteny block?: BlockID0035020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1615 (menE)
    NCTC8325:
    Newman:
    NWMN_1686 (memE)
    USA300_FPR3757:
    04-02981:
    SA2981_1752 (menE)
    08BA02176:
    C248_1841
    11819-97:
    MS7_1795 (menE)
    71193:
    ST398NM01_1844
    ECT-R 2:
    ECTR2_1631 (menE)
    ED133:
    SAOV_1777
    ED98:
    SAAV_1806
    HO 5096 0412:
    SAEMRSA15_17040
    JH1:
    SaurJH1_1883
    JH9:
    SaurJH9_1847
    JKD6008:
    SAA6008_01772
    JKD6159:
    SAA6159_01714
    LGA251:
    SARLGA251_16800
    M013:
    M013TW_1806
    MRSA252:
    SAR1877
    MSHR1132:
    SAMSHR1132_16410
    MSSA476:
    SAS1717
    Mu3:
    SAHV_1782 (menE)
    Mu50:
    SAV1797 (menE)
    MW2:
    MW1735 (menE)
    RF122:
    SAB1651c
    ST398:
    SAPIG1844 (menE)
    T0131:
    SAT0131_01912 (norA)
    TCH60:
    HMPREF0772_11360 (menE2)
    TW20:
    SATW20_17860
    USA300_TCH1516:
    USA300HOU_1784
    VC40:
    SAVC_08195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDFWLYKQAQQNGHHIAITDGQESYTYQNLYCEASLLAKRLKAYQQSRVGLYIDNSIQSI
    N315            MDFWLYKQAQQNGHHIAITDGQESYTYQNLYCEASLLAKRLKAYQQSRVGLYIDNSIQSI
    NCTC8325        MDFWLYKQAQQNGHHIAITDGQESYTYQNLYCEASLLAKRLKAYQQSRVGLYIDNSIQSI
    Newman          MDFWLYKQAQQNGHHIAITDGQESYTYQNLYCEASLLAKRLKAYQQSRVGLYIDNSIQSI
    USA300_FPR3757  MDFWLYKQAQQNGHHIAITDGQESYTYQNLYCEASLLAKRLKAYQQSRVGLYIDNSIQSI
                    ************************************************************

    COL             ILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQLIFCTLPLELRGFQIVSLDDIEFAG
    N315            ILIHACWLANIEIAMINTRLTPNEMTNQMRSIDVQLIFCTLPLELRGFQIVSLDDIEFAG
    NCTC8325        ILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQLIFCTLPLELRGFQIVSLDDIEFAG
    Newman          ILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQLIFCTLPLELRGFQIVSLDDIEFAG
    USA300_FPR3757  ILIHACWLANIEIAMINTRLTPNEMTNQMKSIDVQLIFCTLPLELRGFQIVSLDDIEFAG
                    *****************************:******************************

    COL             RDITTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVP
    N315            RDITTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVP
    NCTC8325        RDITTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVP
    Newman          RDITTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVP
    USA300_FPR3757  RDITTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVP
                    ******.**********:******************************************

    COL             QTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQ
    N315            QTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQ
    NCTC8325        QTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQ
    Newman          QTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQ
    USA300_FPR3757  QTFRNHYASAIGCKESLGFDRDTNWLSVLPIYHISGLSVLLRAVIEGFTVRIVDKFNAEQ
                    ************************************************************

    COL             ILTMIKNERITHISLVPQTLNWLMQQGLHEPYNLQKILLGGAKLSATMIETALQYNLPIY
    N315            ILTMIKNERITHISLVPQTLNWLMQQGLHEPYNLQKILLGGAKLSATMIETALQYNLPIY
    NCTC8325        ILTMIKNERITHISLVPQTLNWLMQQGLHEPYNLQKILLGGAKLSATMIETALQYNLPIY
    Newman          ILTMIKNERITHISLVPQTLNWLMQQGLHEPYNLQKILLGGAKLSATMIETALQYNLPIY
    USA300_FPR3757  ILTMIKNERITHISLVPQTLNWLMQQGLHEPYNLQKILLGGAKLSATMIETALQYNLPIY
                    ************************************************************

    COL             NSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPNKEGHGELMIKGANVMNVY
    N315            NSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPNKEGHGELMIKGANVMNGY
    NCTC8325        NSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPNKEGHGELMIKGANVMNVY
    Newman          NSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPNKEGHGELMIKGANVMNVY
    USA300_FPR3757  NSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPNKEGHGELMIKGANVMNVY
                    ********************************************************** *

    COL             LYPTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIYPYQIETVAKQFPG
    N315            LYPTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIYPYQIETVAKQFPG
    NCTC8325        LYPTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIYPYQIETVAKQFPG
    Newman          LYPTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIYPYQIETVAKQFPG
    USA300_FPR3757  LYPTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIYPYQIETVAKQFPG
                    ************************************************************

    COL             ISDAVCVGHPDDTWGQVPKLYFVSESDISKAQLIAYLSQHLAKYKVPKHFEKVDTLPYTS
    N315            ISDAVCVGHPDDTWGQVPKLYFVSESDISKAQLIAYLSKHLAKYKVPKHFEKVDTLPYTS
    NCTC8325        ISDAVCVGHPDDTWGQVPKLYFVSESDISKAQLIAYLSQHLAKYKVPKHFEKVDTLPYTS
    Newman          ISDAVCVGHPDDTWGQVPKLYFVSESDISKAQLIAYLSQHLAKYKVPKHFEKVDTLPYTS
    USA300_FPR3757  ISDAVCVGHPDDTWGQVPKLYFVSESDISKAQLIAYLSQHLAKYKVPKHFEKVDTLPYTS
                    **************************************:*********************

    COL             TGKLQRNKLYRG
    N315            TGKLQRNKLYRG
    NCTC8325        TGKLQRNKLYRG
    Newman          TGKLQRNKLYRG
    USA300_FPR3757  TGKLQRNKLYRG
                    ************