From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004572000
  • symbol?: epiG
  • description?: epidermin immunity protein F

      descriptions from strain specific annotations:

    • epidermin immunity protein F
    • lantibiotic ABC transporter protein
    • lantibiotic epidermin immunity protein F
    • lantibiotic immunity protein
    • putative lantibiotic ABC transporter protein
  • strand?: -
  • coordinates?: 4805058..4805756
  • synteny block?: BlockID0035600
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1871 (epiG)
    N315:
    NCTC8325:
    Newman:
    NWMN_1709 (bsaG)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1816
    71193:
    ECT-R 2:
    ED133:
    SAOV_1800
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_16990
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1739
    Mu3:
    Mu50:
    MW2:
    MW1758 (bsaG)
    RF122:
    SAB1676c
    ST398:
    T0131:
    SAT0131_01936
    TCH60:
    TW20:
    SATW20_18130
    USA300_TCH1516:
    USA300HOU_1808 (epiG)
    VC40:
    SAVC_08315

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MIINELKSCKLKFSKQALTFVPIIVTILFILFINWYLNVNLWNGRQISLFTASFNA
    NCTC8325        ----MIINELKSCKLKFSKQALTFVPIIVTILFILFINWYLNVNLWNGRQISLFTASFNA
    Newman          MAIKMIINELKSCKLKFSKQALTFVPIIVTILFILFINWYLNVNLWNGRQISLFTASFNA
    USA300_FPR3757  ----MIINELKSCKLKFSKQALTFVPIIVTILFILFINWYLNVNLWNGRQISLFTASFNA
                        ********************************************************

    COL             ITSLLISINVYQVINFEENIGHFNHILGKANRLNWLNASMIFTYTITAICILLASINLLW
    NCTC8325        ITSLLISINVYQVINFEENIGHFNHILGKANRLNWLNASMIFTYTITAICILLASINLLW
    Newman          ITSLLISINVYQVINFEENIGHFNHILGKANRLNWLNASMIFTYTITAICILLASINLLW
    USA300_FPR3757  ITSLLISINVYQVINFEENIGHFNHILGKANRLNWLNASMIFTYTITAICILLASINLLW
                    ************************************************************

    COL             HSHDMKITLMFIGVSLFFNVIILLLLFIFSIFIKDVMAIVVGVLMFIFNVYFGLEVLGDH
    NCTC8325        HSHDMKITLMFIGVSLFFNVIILLLLFIFSIFIKDVMAIVVGVLMFIFNVYFGLEVLGDH
    Newman          HSHDMKITLMFIGVSLFFNVIILLLLFIFSIFIKDVMAIVVGVLMFIFNVYFGLEVLGDH
    USA300_FPR3757  HSHDMKITLMFIGVSLFFNVIILLLLFIFSIFIKDVMAIVVGVLMFIFNVYFGLEVLGDH
                    ************************************************************

    COL             SWFYLPITYATRYVYMFIEGSIPVTLTLAIYIIITLLLAVLLFKGFNKWSGRTIKD
    NCTC8325        SWFYLPITYATRYVYMFIEGSIPVTLTLAIYIIITLLLAVLLFKGFNKWSGRTIKD
    Newman          SWFYLPITYATRYVYMFIEGSIPVTLTLAIYIIITLLLAVLLFKGFNKWSGRTIKD
    USA300_FPR3757  SWFYLPITYATRYVYMFIEGSIPVTLTLAIYIIITLLLAVLLFKGFNKWSGRTIKD
                    ********************************************************