From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004584000
  • symbol?: epiB
  • description?: lantibiotic epidermin biosynthesis protein EpiB

      descriptions from strain specific annotations:

    • lantibiotic epidermin biosynthesis protein EpiB
    • epidermin biosynthesis protein EpiB
    • lantibiotic biosynthesis protein
    • pseudogene
    • thiopeptide-type bacteriocin biosynthesis domain protein
  • strand?: -
  • coordinates?: 4819612..4824116
  • synteny block?: BlockID0035600
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1877 (epiB)
    N315:
    NCTC8325:
    Newman:
    NWMN_1715 (bsaB)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1822
    71193:
    ECT-R 2:
    ED133:
    SAOV_1806
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_17050
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1745
    Mu3:
    Mu50:
    MW2:
    MW1764 (bsaB)
    RF122:
    SAB1682c
    ST398:
    T0131:
    SAT0131_01943
    TCH60:
    TW20:
    SATW20_18190
    USA300_TCH1516:
    USA300HOU_1814 (epiB)
    VC40:
    SAVC_08345

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTIYEPSSICMIRTPLLSVEFFNLFLNTEQIKYSDLQLNAQMKESILTTTFNLYCTLQE
    NCTC8325        MNTIYEPSSICMIRTPLLSVEFFNLFLNTEQIKYSDLQLNAQMKESILTTTFNLYCTLQE
    Newman          MNTIYEPSSICMIRTPLLSVEFFNLFLNTEQIKYSDLQLNAQMKESILTTTFNLYCTLQE
    USA300_FPR3757  MNTIYEPSSICMIRTPLLSVEFFNLFLNTEQIKYSDLQLNAQMKESILTTTFNLYCTLQE
                    ************************************************************

    COL             INFDGDNKKVRDAKESLLKYLIRMSTRPTPFGLLSGINLGHFVNEPTRLKVGNSIQKYVK
    NCTC8325        INFDGDNKKVRDAKESLLKYLIRMSTRPTPFGLLSGINLGHFVNEPTRLKVGNSIQKYVK
    Newman          INFDGDNKKVRDAKESLLKYLIRMSTRPTPFGLLSGINLGHFVNEPTRLKVGNSIQKYVK
    USA300_FPR3757  INFDGDNKKVRDAKESLLKYLIRMSTRPTPFGLLSGINLGHFVNEPTRLKVGNSIQKYVK
                    ************************************************************

    COL             VDGEWLYKLVSYIESIDEYYQNLKVIWNSKAHIINDRIYLNEQSAIYLNNNKDTSFSIKN
    NCTC8325        VDGEWLYKLVSYIESIDEYYQNLKVIWNSKAHIINDRIYLNEQSAIYLNNNKDTSFSIKN
    Newman          VDGEWLYKLVSYIESIDEYYQNLKVIWNSKAHIINDRIYLNEQSAIYLNNNKDTSFSIKN
    USA300_FPR3757  VDGEWLYKLVSYIESIDEYYQNLKVIWNSKAHIINDRIYLNEQSAIYLNNNKDTSFSIKN
                    ************************************************************

    COL             SELLVFIKTTVTNNNITFSNLAEKINQEFEINDITKVKVYIHNLVSKEIIYSTIRPPLSY
    NCTC8325        SELLVFIKTTVTNNNITFSNLAEKINQEFEINDITKVKVYIHNLVSKEIIYSTIRPPLSY
    Newman          SELLVFIKTTVTNNNITFSNLAEKINQEFEINDITKVKVYIHNLVSKEIIYSTIRPPLSY
    USA300_FPR3757  SELLVFIKTTVTNNNITFSNLAEKINQEFEINDITKVKVYIHNLVSKEIIYSTIRPPLSY
                    ************************************************************

    COL             SDNLNYILNKLSLHNDDFVKKIREIQKLILAYEKTEIGFGEELYKDIIHHMKALFKCKNY
    NCTC8325        SDNLNYILNKLSLHNDDFVKKIREIQKLILAYEKTEIGFGEELYKDIIHHMKALFKCKNY
    Newman          SDNLNYILNKLSLHNDDFVKKIREIQKLILAYEKTEIGFGEELYKDIIHHMKALFKCKNY
    USA300_FPR3757  SDNLNYILNKLSLHNDDFVKKIREIQKLILAYEKTEIGFGEELYKDIIHHMKALFKCKNY
                    ************************************************************

    COL             LQIDTKIDMINNYLHQDIATNISEAAYLLWLLSRNNIGFTDLKVLHNRFIEKYGFEQLVN
    NCTC8325        LQIDTKIDMINNYLHQDIATNISEAAYLLWLLSRNNIGFTDLKVLHNRFIEKYGFEQLVN
    Newman          LQIDTKIDMINNYLHQDIATNISEAAYLLWLLSRNNIGFTDLKVLHNRFIEKYGFEQLVN
    USA300_FPR3757  LQIDTKIDMINNYLHQDIATNISEAAYLLWLLSRNNIGFTDLKVLHNRFIEKYGFEQLVN
                    ************************************************************

    COL             IKDLISDITGFGTTIFQEEETDGNNIVMLKQKFLHALRNNDEIVINEKDVESLINDNEIN
    NCTC8325        IKDLISDITGFGTTIFQEEETDGNNIVMLKQKFLHALRNNDEIVINEKDVESLINDNEIN
    Newman          IKDLISDITGFGTTIFQEEETDGNNIVMLKQKFLHALRNNDEIVINEKDVESLINDNEIN
    USA300_FPR3757  IKDLISDITGFGTTIFQEEETDGNNIVMLKQKFLHALRNNDEIVINEKDVESLINDNEIN
                    ************************************************************

    COL             HYHAPMSADVYAELYLGRFYNQYNELIVISPLTASFNAGATFGRFHHLIDTETLAKLEHE
    NCTC8325        HYHAPMSADVYAELYLGRFYNQYNELIVISPLTASFNAGATFGRFHHLIDTETLAKLEHE
    Newman          HYHAPMSADVYAELYLGRFYNQYNELIVISPLTASFNAGATFGRFHHLIDTETLAKLEHE
    USA300_FPR3757  HYHAPMSADVYAELYLGRFYNQYNELIVISPLTASFNAGATFGRFHHLIDTETLAKLEHE
                    ************************************************************

    COL             KGHYYQKMICDDNVEMISINNIPKYPRNHNVLTNHDSYEYSLNLGSSNSYSKYELTLDDI
    NCTC8325        KGHYYQKMICDDNVEMISINNIPKYPRNHNVLTNHDSYEYSLNLGSSNSYSKYELTLDDI
    Newman          KGHYYQKMICDDNVEMISINNIPKYPRNHNVLTNHDSYEYSLNLGSSNSYSKYELTLDDI
    USA300_FPR3757  KGHYYQKMICDDNVEMISINNIPKYPRNHNVLTNHDSYEYSLNLGSSNSYSKYELTLDDI
                    ************************************************************

    COL             YVGATFNKLYLYSSQLNKRVIFESNNMYNFLKECNLYRLLREISMESVKCIEPMNDVSID
    NCTC8325        YVGATFNKLYLYSSQLNKRVLFESNNMYNFLKECNLYRLLREISMESVKCIEPMNDVSID
    Newman          YVGATFNKLYLYSSQLNKRVLFESNNMYNFLKECNLYRLLREISMESVKCIEPMNDVSID
    USA300_FPR3757  YVGATFNKLYLYSSQLNKRVLFESNNMYNFLKECNLYRLLREISMESVKCIEPMNDVSID
                    ********************:***************************************

    COL             SFSYSPRIRYKNVILKPAYWKINEMVLPLPKNEEWDQQFLKYQEQFNIPNIVNLVYGDNK
    NCTC8325        SFSYSPRIRYKNVILKPAYWKINEMVLPLPKNEEWDQQFLKYQEQFNIPNIVNLVYGDNK
    Newman          SFSYSPRIRYKNVILKPAYWKINEMVLPLPKNEEWDQQFLKYQEQFNIPNIVNLVYGDNK
    USA300_FPR3757  SFSYSPRIRYKNVILKPAYWKINEMVLPLPKNEEWDQQFLKYQEQFNIPNIVNLVYGDNK
                    ************************************************************

    COL             LLLNLSLANHRYLLMKEYKKHKRVRLVESFLPQSKNDHVYEIVTPIYKKSSYRGPEIEIP
    NCTC8325        LLLNLSLANHRYLLMKEYKKHKRVRLVESFLPQSKNDHVYEIVTPIYKKSSYRGPEIEIP
    Newman          LLLNLSLANHRYLLMKEYKKHKRVRLVESFLPQSKNDHVYEIVTPIYKKSSYRGPEIEIP
    USA300_FPR3757  LLLNLSLANHRYLLMKEYKKHKRVRLVESFLPQSKNDHVYEIVTPIYKKSSYRGPEIEIP
                    ************************************************************

    COL             KYKNTDIEYDKDWFALHIHIDKPSQDTFIIDNLYPFVKHLKDKGDIDQYFLMRYIKQGDI
    NCTC8325        KYKNTDIEYDKDWFALHIHIDKPSQDTFIIDNLYPFVKHLKDKGDIDQYFLMRYIKQGDI
    Newman          KYKNTDIEYDKDWFALHIHIDKPSQDTFIIDNLYPFVKHLKDKGDIDQYFLMRYIKQGDI
    USA300_FPR3757  KYKNTDIEYDKDWFALHIHIDKPSQDTFIIDNLYPFVKHLKDKGDIDQYFLMRYIKQGDI
                    ************************************************************

    COL             LKLRLFRNDENYAEIYSILKNWLPHVRQTTEVSDYEFVSYEPEFFRYGGKNTINEIEAFF
    NCTC8325        LKLRLFRNDENYAEIYSILKNWLPHVRQTTEVSDYEFVSYEPEFFRYGGKNTINEIEAFF
    Newman          LKLRLFRNDENYAEIYSILKNWLPHVRQTTEVSDYEFVSYEPEFFRYGGKNTINEIEAFF
    USA300_FPR3757  LKLRLFRNDENYAEIYSILKNWLPHVRQTTEVSDYEFVSYEPEFFRYGGKNTINEIEAFF
                    ************************************************************

    COL             EYDTNLAVNIIENDFKFDRPYIVAISIMYLFEMFSISNEERMEIVNNYVPTSFKSKDIRP
    NCTC8325        EYDTNLAVNIIENDFKFDRPYIVAISIMYLFEMFSISNEERMEIVNNYVPTSFKSKDIRP
    Newman          EYDTNLAVNIIENDFKFDRPYIVAISIMYLFEMFSISNEERMEIVNNYVPTSFKSKDIRP
    USA300_FPR3757  EYDTNLAVNIIENDFKFDRPYIVAISIMYLFEMFSISNEERMEIVNNYVPTSFKSKDIRP
                    ************************************************************

    COL             FKNELVTICNPANNFEYMAKHYSGIYRILKDGNQILSKLNEGLKKTLTTKRSRIIGSLIH
    NCTC8325        FKNELVTICNPANNFEYMAKHYSGIYRILKDGNQILSKLNEGLKKTLTTKRSRIIGSLIH
    Newman          FKNELVTICNPANNFEYMAKHYSGIYRILKDGNQILSKLNEGLKKTLTTKRSRIIGSLIH
    USA300_FPR3757  FKNELVTICNPANNFEYMAKHYSGIYRILKDGNQILSKLNEGLKKTLTTKRSRIIGSLIH
                    ************************************************************

    COL             MRCNRIFGIDKDQETFVLSIVKEIVKTQKHWCGDKND
    NCTC8325        MRCNRIFGIDKDQETFVLSIVKEIVKTQKHWCGDKND
    Newman          MRCNRIFGIDKDQETFVLSIVKEIVKTQKHWCGDKND
    USA300_FPR3757  MRCNRIFGIDKDQETFVLSIVKEIVKTQKHWCGDKND
                    *************************************