From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004764000
  • symbol?:
  • description?: exported protein

      descriptions from strain specific annotations:

    • exported protein
    • gas vesicle protein
    • Gas vesicle protein-like protein
  • strand?: +
  • coordinates?: 4977365..4977730
  • synteny block?: BlockID0036960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1795
    08BA02176:
    C248_1880
    11819-97:
    MS7_1844
    71193:
    ST398NM01_1904
    ECT-R 2:
    ECTR2_1681
    ED133:
    SAOV_1834
    ED98:
    SAAV_1858
    HO 5096 0412:
    SAEMRSA15_17430
    JH1:
    SaurJH1_1926
    JH9:
    SaurJH9_1892
    JKD6008:
    SAA6008_01796 (gvpP)
    JKD6159:
    SAA6159_01767 (gvpP)
    LGA251:
    SARLGA251_17220
    M013:
    M013TW_1845
    MRSA252:
    SAR1930
    MSHR1132:
    SAMSHR1132_16850
    MSSA476:
    SAS1760
    Mu3:
    SAHV_1824
    Mu50:
    SAV1839
    MW2:
    MW1779
    RF122:
    SAB1770
    ST398:
    SAPIG1904
    T0131:
    SAT0131_01959
    TCH60:
    HMPREF0772_11306
    TW20:
    SATW20_18330
    USA300_TCH1516:
    USA300HOU_1831
    VC40:
    SAVC_08425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFND
    N315            MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFND
    NCTC8325        MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFND
    Newman          MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFND
    USA300_FPR3757  MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFND
                    ************************************************************

    COL             ILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEIS
    N315            ILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEIS
    NCTC8325        ILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEIS
    Newman          ILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEIS
    USA300_FPR3757  ILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEIS
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *