From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004769000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 4978694..4979233
  • synteny block?: BlockID0037010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1796
    08BA02176:
    C248_1882
    11819-97:
    MS7_1845
    71193:
    ST398NM01_1906
    ECT-R 2:
    ECTR2_1682
    ED133:
    SAOV_1836
    ED98:
    SAAV_1859
    HO 5096 0412:
    SAEMRSA15_17450
    JH1:
    SaurJH1_1927
    JH9:
    SaurJH9_1893
    JKD6008:
    SAA6008_01797
    JKD6159:
    SAA6159_01768
    LGA251:
    SARLGA251_17230
    M013:
    M013TW_1846
    MRSA252:
    SAR1931
    MSHR1132:
    SAMSHR1132_16860
    MSSA476:
    SAS1761
    Mu3:
    SAHV_1825
    Mu50:
    SAV1840
    MW2:
    MW1781
    RF122:
    SAB1773
    ST398:
    SAPIG1906
    T0131:
    SAT0131_01960
    TCH60:
    HMPREF0772_11304
    TW20:
    SATW20_18340
    USA300_TCH1516:
    USA300HOU_1832
    VC40:
    SAVC_08430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFLCKRQIDINARFGLPRIAFMSAVATIIMFLVSYEVMYFLSNTPLSDRHFLIFLLLVFM
    N315            MFLCKRQIDINARFGLPRIAFMSAVATIIMFLVSYEVMYFLSNTPLSDRHFLIFLLLVFM
    NCTC8325        MFLCKRQIDINARFGLPRIAFMSAVATIIMFLVSYEVMYFLSNTPLSDRHFLIFLLLVFM
    Newman          MFLCKRQIDINARFGLPRIAFMSAVATIIMFLVSYEVMYFLSNTPLSDRHFLIFLLLVFM
    USA300_FPR3757  MFLCKRQIDINARFGLPRIAFMSAVATIIMFLVSYEVMYFLSNTPLSDRHFLIFLLLVFM
                    ************************************************************

    COL             TYPLHKSIHLLFFLPYRKSFKVHKLTKRKWLIFYNTYVNQPVHKFYFCINLILPLIILSA
    N315            TYPLHKSIHLLFFLPYRKSFKVHKLTKRKWLIFYNTYVNQPVHKFYFCINLILPLIILSA
    NCTC8325        TYPLHKSIHLLFFLPYRKSFKVHKLTKRKWLIFYNTYVNQPVHKFYFCINLILPLIILSA
    Newman          TYPLHKSIHLLFFLPYRKSFKVHKLTKRKWLIFYNTYVNQPVHKFYFCINLILPLIILSA
    USA300_FPR3757  TYPLHKSIHLLFFLPYRKSFKVHKLTKRKWLIFYNTYVNQPVHKFYFCINLILPLIILSA
                    ************************************************************

    COL             MFVYLTISFPQYGHYFMFLLALNFGISITDLLYLKIIIFSNYGQYIEEHSTGINILKKIK
    N315            MFVYLTISFPQYGHYFMFLLALNFGISITDLLYLKIIIFSNYGQYIEEHSTGINILKKIK
    NCTC8325        MFVYLTISFPQYGHYFMFLLALNFGISITDLLYLKIIIFSNYGQYIEEHSTGINILKKIK
    Newman          MFVYLTISFPQYGHYFMFLLALNFGISITDLLYLKIIIFSNYGQYIEEHSTGINILKKIK
    USA300_FPR3757  MFVYLTISFPQYGHYFMFLLALNFGISITDLLYLKIIIFSNYGQYIEEHSTGINILKKIK
                    ************************************************************

    COL             NPYHL
    N315            NPYHL
    NCTC8325        NPYHL
    Newman          NPYHL
    USA300_FPR3757  NPYHL
                    *****