From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004772000
  • symbol?: cbf1
  • description?: 3'-5' exoribonuclease

      descriptions from strain specific annotations:

    • 3'-5' exoribonuclease
    • 3'-5' exoribonuclease YhaM
    • CMP-binding-factor 1
    • Metal dependent phosphohydrolase
    • OB-fold nucleic acid binding domain-containing protein
    • CMP-binding factor
  • strand?: -
  • coordinates?: 4980619..4981560
  • synteny block?: BlockID0037040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1898 (cbf1)
    N315:
    SA1660 (cbf1)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1798 (cbf1)
    08BA02176:
    C248_1884
    11819-97:
    MS7_1847
    71193:
    ST398NM01_1908
    ECT-R 2:
    ECTR2_1684
    ED133:
    SAOV_1838
    ED98:
    SAAV_1861 (cbf1)
    HO 5096 0412:
    SAEMRSA15_17470
    JH1:
    SaurJH1_1929
    JH9:
    SaurJH9_1895
    JKD6008:
    SAA6008_01799 (yhaM)
    JKD6159:
    SAA6159_01770 (yhaM)
    LGA251:
    SARLGA251_17250
    M013:
    M013TW_1848
    MRSA252:
    SAR1933
    MSHR1132:
    SAMSHR1132_16880
    MSSA476:
    SAS1763
    Mu3:
    SAHV_1827 (cbf1)
    Mu50:
    SAV1842 (cbf1)
    MW2:
    MW1783 (cbf1)
    RF122:
    SAB1775c
    ST398:
    SAPIG1908
    T0131:
    SAT0131_01962
    TCH60:
    HMPREF0772_11302 (cbf)
    TW20:
    SATW20_18360
    USA300_TCH1516:
    USA300HOU_1834
    VC40:
    SAVC_08450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNIENLNPGDSVDHFFLVHKATQGVTAQGKDYMTLHLQDKSGEIEAKFWTATKNDMATI
    N315            MRNIENLNPGDSVDHFFLVHKATQGVTAQGKDYMTLHLQDKSGEIEAKFWTATKNDMATI
    NCTC8325        MRNIENLNPGDSVDHFFLVHKATQGVTAQGKDYMTLHLQDKSGEIEAKFWTATKNDMATI
    Newman          MRNIENLNPGDSVDHFFLVHKATQGVTAQGKDYMTLHLQDKSGEIEAKFWTATKNDMATI
    USA300_FPR3757  MRNIENLNPGDSVDHFFLVHKATQGVTAQGKDYMTLHLQDKSGEIEAKFWTATKNDMATI
                    ************************************************************

    COL             KPEEIVHVKGDIINYRGNKQMKVNQIRLATTEDQLKTEQFVDGAPLSPAEIQEEISHYLL
    N315            KPEEIVHVKGDIINYRGNKQMKVNQIRLATTEDQLKTEQFVDGAPLSPAEIQEEISHYLL
    NCTC8325        KPEEIVHVKGDIINYRGNKQMKVNQIRLATTEDQLKTEQFVDGAPLSPAEIQEEISHYLL
    Newman          KPEEIVHVKGDIINYRGNKQMKVNQIRLATTEDQLKTEQFVDGAPLSPAEIQEEISHYLL
    USA300_FPR3757  KPEEIVHVKGDIINYRGNKQMKVNQIRLATTEDQLKTEQFVDGAPLSPAEIQEEISHYLL
                    ************************************************************

    COL             DIENANLQRITRHLLKKYQERFYTYPAASSHHHNFASGLSYHVLTMLRIAKSICDIYPLL
    N315            DIENANLQRITRHLLKKYQERFYTYPAASSHHHNFASGLSYHVLTMLRIAKSICDIYPLL
    NCTC8325        DIENANLQRITRHLLKKYQERFYTYPAASSHHHNFASGLSYHVLTMLRIAKSICDIYPLL
    Newman          DIENANLQRITRHLLKKYQERFYTYPAASSHHHNFASGLSYHVLTMLRIAKSICDIYPLL
    USA300_FPR3757  DIENANLQRITRHLLKKYQERFYTYPAASSHHHNFASGLSYHVLTMLRIAKSICDIYPLL
                    ************************************************************

    COL             NKSLLYSGIILHDIGKVRELSGPVATSYTVEGNLLGHISIASDEVVEAARELNIEGEEIM
    N315            NKSLLYSGIILHDIGKVRELSGPVATSYTVEGNLLGHISIASDEVVEAARELNIEGEEIM
    NCTC8325        NKSLLYSGIILHDIGKVRELSGPVATSYTVEGNLLGHISIASDEVVEAARELNIEGEEIM
    Newman          NKSLLYSGIILHDIGKVRELSGPVATSYTVEGNLLGHISIASDEVVEAARELNIEGEEIM
    USA300_FPR3757  NKSLLYSGIILHDIGKVRELSGPVATSYTVEGNLLGHISIASDEVVEAARELNIEGEEIM
                    ************************************************************

    COL             LLRHMILSHHGKLEYGSPKLPYLKEAEILCYIDNIDARMNMFEKAYKKTDKGQFTDKIFG
    N315            LLRHMILSHHGKLEYGSPKLPYLKEAEILCYIDNIDARMNMFEKAYKKTDKGQFTDKIFG
    NCTC8325        LLRHMILSHHGKLEYGSPKLPYLKEAEILCYIDNIDARMNMFEKAYKKTDKGQFTDKIFG
    Newman          LLRHMILSHHGKLEYGSPKLPYLKEAEILCYIDNIDARMNMFEKAYKKTDKGQFTDKIFG
    USA300_FPR3757  LLRHMILSHHGKLEYGSPKLPYLKEAEILCYIDNIDARMNMFEKAYKKTDKGQFTDKIFG
                    ************************************************************

    COL             LENRRFYNPESLD
    N315            LENRRFYNPESLD
    NCTC8325        LENRRFYNPESLD
    Newman          LENRRFYNPESLD
    USA300_FPR3757  LENRRFYNPESLD
                    *************