From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004780000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • DNA-binding protein
    • XRE family transcriptional regulator
    • transcriptional regulator, putative
    • putative DNA-binding protein
    • helix-turn-helix domain protein
    • HTH domain protein, binds to mecA promoter region
    • cro/CI family transcriptional regulator
    • pbsX family transcriptional regulator
    • helix-turn-helix family protein
  • strand?: -
  • coordinates?: 4990249..4990713
  • synteny block?: BlockID0037120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1803
    08BA02176:
    C248_1890
    11819-97:
    MS7_1852
    71193:
    ST398NM01_1913
    ECT-R 2:
    ECTR2_1689
    ED133:
    SAOV_1844
    ED98:
    SAAV_1866
    HO 5096 0412:
    SAEMRSA15_17520
    JH1:
    SaurJH1_1935
    JH9:
    SaurJH9_1901
    JKD6008:
    SAA6008_01804
    JKD6159:
    SAA6159_01775
    LGA251:
    SARLGA251_17300
    M013:
    M013TW_1853
    MRSA252:
    SAR1938
    MSHR1132:
    SAMSHR1132_16930
    MSSA476:
    SAS1768
    Mu3:
    SAHV_1832
    Mu50:
    SAV1847
    MW2:
    MW1788
    RF122:
    SAB1780c
    ST398:
    SAPIG1913
    T0131:
    SAT0131_01967
    TCH60:
    HMPREF0772_11297
    TW20:
    SATW20_18410
    USA300_TCH1516:
    USA300HOU_1841
    VC40:
    SAVC_08475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDRQSFTDLIQTKFKMVRIEAGYTQDTMAQTIGLSKKTLVQIEKERVLPNWTTCISICAL
    N315            MDRQSFTDLIQTKFKMVRIEAGYTQDTMAQTIGLSKKTLVQIEKERVLPNWTTCISICAL
    NCTC8325        MDRQSFTDLIQTKFKMVRIEAGYTQDTMAQTIGLSKKTLVQIEKERVLPNWTTCISICAL
    Newman          MDRQSFTDLIQTKFKMVRIEAGYTQDTMAQTIGLSKKTLVQIEKERVLPNWTTCISICAL
    USA300_FPR3757  MDRQSFTDLIQTKFKMVRIEAGYTQDTMAQTIGLSKKTLVQIEKERVLPNWTTCISICAL
                    ************************************************************

    COL             FRDSEVLNSTFGCDPLEIVQTISRNHCAYPNHAPTSDIYWNNIETRNGYILQSNKVSNIY
    N315            FRDSEVLNSTFGCDPLEIVQTISRNHCAYPNHAPTSDIYWNNIETRNGYILQSNKVSNIY
    NCTC8325        FRDSEVLNSTFGCDPLEIVQTISRNHCAYPNHAPTSDIYWNNIETRNGYILQSNKVSNIY
    Newman          FRDSEVLNSTFGCDPLEIVQTISRNHCAYPNHAPTSDIYWNNIETRNGYILQSNKVSNIY
    USA300_FPR3757  FRDSEVLNSTFGCDPLEIVQTISRNHCAYPNHAPTSDIYWNNIETRNGYILQSNKVSNIY
                    ************************************************************

    COL             RVLNPDNQPIFGTSKMREAETYFNRNAKEELVHI
    N315            RVLNPDNQPIFGTSKMREAETYFNRNAKEELVHI
    NCTC8325        RVLNPDNQPIFGTSKMREAETYFNRNAKEELVHI
    Newman          RVLNPDNQPIFGTSKMREAETYFNRNAKEELVHI
    USA300_FPR3757  RVLNPDNQPIFGTSKMREAETYFNRNAKEELVHI
                    **********************************