From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004840000
  • symbol?: perR
  • description?: transcriptional repressor

      descriptions from strain specific annotations:

    • transcriptional repressor
    • FUR family transcriptional regulator
    • ferric uptake regulator-like protein
    • transcriptional regulator Fur family protein
    • peroxide-responsive repressor PerR
    • peroxide operon regulator
    • Peroxide stress regulator PerR, FUR family
    • ferric-uptake regulator
    • ferric uptake regulator family protein
    • putative peroxide operon regulator
  • strand?: -
  • coordinates?: 5049105..5049551
  • synteny block?: BlockID0037700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1817 (perR)
    08BA02176:
    C248_1932 (perR)
    11819-97:
    MS7_1896 (perR)
    71193:
    ST398NM01_1954
    ECT-R 2:
    ECTR2_1732
    ED133:
    SAOV_1888 (perR)
    ED98:
    SAAV_1911
    HO 5096 0412:
    SAEMRSA15_17680 (perR)
    JH1:
    SaurJH1_1949
    JH9:
    SaurJH9_1915
    JKD6008:
    SAA6008_01818 (perR)
    JKD6159:
    SAA6159_01792 (perR)
    LGA251:
    SARLGA251_17430 (perR)
    M013:
    M013TW_1895
    MRSA252:
    SAR1951 (perR)
    MSHR1132:
    SAMSHR1132_17060
    MSSA476:
    SAS1783
    Mu3:
    SAHV_1846
    Mu50:
    SAV1861
    MW2:
    MW1801
    RF122:
    SAB1794c (perR)
    ST398:
    SAPIG1954
    T0131:
    SAT0131_01983
    TCH60:
    HMPREF0772_11284
    TW20:
    SATW20_18550 (perR)
    USA300_TCH1516:
    USA300HOU_1856
    VC40:
    SAVC_08560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNI
    N315            MSVEIESIEHELEESIASLRQAGIRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNI
    NCTC8325        MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNI
    Newman          MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNI
    USA300_FPR3757  MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNI
                    ***********************:************************************

    COL             SVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIE
    N315            SVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIE
    NCTC8325        SVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIE
    Newman          SVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIE
    USA300_FPR3757  SVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIE
                    ************************************************************

    COL             RLAQHMTDFDVTHHRMEIYGVCKECQDK
    N315            RLAQHMTDFDVTHHRMEIYGVCKECQDK
    NCTC8325        RLAQHMTDFDVTHHRMEIYGVCKECQDK
    Newman          RLAQHMTDFDVTHHRMEIYGVCKECQDK
    USA300_FPR3757  RLAQHMTDFDVTHHRMEIYGVCKECQDK
                    ****************************