From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004845000
  • symbol?:
  • description?: aromatic acid exporter family protein

      descriptions from strain specific annotations:

    • aromatic acid exporter family protein
    • integral membrane protein
    • membrane protein
    • putative lipo protein
  • strand?: +
  • coordinates?: 5052647..5053832
  • synteny block?: BlockID0037750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1821
    08BA02176:
    C248_1936
    11819-97:
    MS7_1900
    71193:
    ST398NM01_1958
    ECT-R 2:
    ECTR2_1736
    ED133:
    SAOV_1892
    ED98:
    SAAV_1915
    HO 5096 0412:
    SAEMRSA15_17720
    JH1:
    SaurJH1_1953
    JH9:
    SaurJH9_1919
    JKD6008:
    SAA6008_01822
    JKD6159:
    SAA6159_01796
    LGA251:
    SARLGA251_17470
    M013:
    M013TW_1899
    MRSA252:
    SAR1955
    MSHR1132:
    SAMSHR1132_17100
    MSSA476:
    SAS1787
    Mu3:
    SAHV_1850
    Mu50:
    SAV1865
    MW2:
    MW1805
    RF122:
    SAB1798
    ST398:
    SAPIG1958
    T0131:
    SAT0131_01987
    TCH60:
    HMPREF0772_11279
    TW20:
    SATW20_18590
    USA300_TCH1516:
    USA300HOU_1860
    VC40:
    SAVC_08580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLGARIFKTGIAIILAMSIASLLPDDVGLKALAGVSAVVAMQPSIYRSFKTVSDQALGN
    N315            MRLGARIFKTGIAIILAMSIASLLPDDVGLKALAGVSAVVAMQPSIYRSFKTVSDQALGN
    NCTC8325        -----------------MSIASLLPDDVGLKALAGVSAVVAMQPSIYRSFKTVSDQALGN
    Newman          MRLGARIFKTGIAIILAMSIASLLPDDVGLKALAGVSAVVAMQPSIYRSFKTVSDQALGN
    USA300_FPR3757  -----------------MSIASLLPDDVGLKALAGVSAVVAMQPSIYRSFKTVSDQALGN
                                     *******************************************

    COL             IIGAILSVTMVTIFSDNFIIMGVTVIVLIAILFKFNLAHVATLASVTALIIMGQHTGSFY
    N315            IIGAILSVTMVTIFSDNFIIMGVTVIVLIAILFKFNLAHVATLASVTALIIMGQHTGSFY
    NCTC8325        IIGAILSVTMVTIFSDNFIIMGVTVIVLIAILFKFNLAHVATLASVTALIIMGQHTGSFY
    Newman          IIGAILSVTMVTIFSDNFIIMGVTVIVLIAILFKFNLAHVATLASVTALIIMGQHTGSFY
    USA300_FPR3757  IIGAILSVTMVTIFSDNFIIMGVTVIVLIAILFKFNLAHVATLASVTALIIMGQHTGSFY
                    ************************************************************

    COL             ITAFYRFVLVMIGVISSSLVNFVFLPPKFETKIYYNSLNISSDIFMWFKLVLNDTTEFNN
    N315            ITAFYRFVLVMIGVISSSLVNFVFLPPKFETKIYYNSLNISSDIFMWFKLVLNDTTEFNN
    NCTC8325        ITAFYRFVLVMIGVISSSLVNFVFLPPKFETKIYYNSLNISSDIFMWFKLVLNDTTEFNN
    Newman          ITAFYRFVLVMIGVISSSLVNFVFLPPKFETKIYYNSLNISSDIFMWFKLVLNDTTEFNN
    USA300_FPR3757  ITAFYRFVLVMIGVISSSLVNFVFLPPKFETKIYYNSLNISSDIFMWFKLVLNDTTEFNN
                    ************************************************************

    COL             IKQDSHNLKQRVEKLEKIYDYYSEERPITKKHIHQQNRKKILFREVVQTTRQAYEVLNKL
    N315            IKQDSHNLKQRVEKLEKIYDYYSEERPITKKHIHQQNRKKILFREVVQTTRQAYEVLNKL
    NCTC8325        IKQDSHNLKQRVEKLEKIYDYYSEERPITKKHIHQQNRKKILFREVVQTTRQAYEVLNKL
    Newman          IKQDSHNLKQRVEKLEKIYDYYSEERPITKKHIHQQNRKKILFREVVQTTRQAYEVLNKL
    USA300_FPR3757  IKQDSHNLKQRVEKLEKIYDYYSEERPITKKHIHQQNRKKILFREVVQTTRQAYEVLNKL
                    ************************************************************

    COL             SRYQNDLYLLNNNFLLQIKLDLDSLTAFHEQILASLSKKARYNVTHVDYELDNPQKKDLL
    N315            SRYQNDLYLLNNNFLLQIKLDLDSLTAFHEQILASLSKKARYNVTHVDYELDNPQKKDLL
    NCTC8325        SRYQNDLYLLNNNFLLQIKLDLDSLTAFHEQILASLSKKARYNVTHVDYELDNPQKKDLL
    Newman          SRYQNDLYLLNNNFLLQIKLDLDSLTAFHEQILASLSKKARYNVTHVDYELDNPQKKDLL
    USA300_FPR3757  SRYQNDLYLLNNNFLLQIKLDLDSLTAFHEQILASLSKKARYNVTHVDYELDNPQKKDLL
                    ************************************************************

    COL             STFQHELINHPYQTEYSFANVMQIVAAIEEYRHHLEHLDRIRISFFTYHRSDADIEIVEE
    N315            STFQHELINHPYQTEYSFANVMQIVAAIEEYRHHLEHLDRIRISFFTYHRSDADIEIVEE
    NCTC8325        STFQHELINHPYQTEYSFANVMQIVAAIEEYRHHLEHLDRIRISFFTYHRSDADIEIVEE
    Newman          STFQHELINHPYQTEYSFANVMQIVAAIEEYRHHLEHLDRIRISFFTYHRSDADIEIVEE
    USA300_FPR3757  STFQHELINHPYQTEYSFANVMQIVAAIEEYRHHLEHLDRIRISFFTYHRSDADIEIVEE
                    ************************************************************

    COL             DFDL
    N315            DFDL
    NCTC8325        DFDL
    Newman          DFDL
    USA300_FPR3757  DFDL
                    ****