From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004851000
  • symbol?:
  • description?: metal-dependent hydrolase

      descriptions from strain specific annotations:

    • metal-dependent hydrolase
    • membrane-bound metal-dependent hydrolase
    • membrane protein
    • membrane spanning protein
    • yfhP
    • YfhP protein
  • strand?: +
  • coordinates?: 5058112..5059089
  • synteny block?: BlockID0037810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1825
    08BA02176:
    C248_1940
    11819-97:
    MS7_1904
    71193:
    ST398NM01_1962
    ECT-R 2:
    ECTR2_1740
    ED133:
    SAOV_1896
    ED98:
    SAAV_1919
    HO 5096 0412:
    SAEMRSA15_17760
    JH1:
    SaurJH1_1957
    JH9:
    SaurJH9_1923
    JKD6008:
    SAA6008_01826
    JKD6159:
    SAA6159_01800
    LGA251:
    SARLGA251_17510
    M013:
    M013TW_1905
    MRSA252:
    SAR1959
    MSHR1132:
    SAMSHR1132_17140
    MSSA476:
    SAS1791
    Mu3:
    SAHV_1854
    Mu50:
    SAV1869
    MW2:
    MW1809
    RF122:
    SAB1802
    ST398:
    SAPIG1962
    T0131:
    SAT0131_01991
    TCH60:
    HMPREF0772_11275 (yfhP)
    TW20:
    SATW20_18630
    USA300_TCH1516:
    USA300HOU_1864
    VC40:
    SAVC_08600

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDTATHIAIGVGLTALATQDPAMASTFGATATTLIVGSLIPDGDTVLKLKDNATYISHHR
    N315            MDTATHIAIGVGLTALATQDPAMASTFGATATTLIVGSLIPDGDTVLKLKDNATYISHHR
    NCTC8325        MDTATHIAIGVGLTALATQDPAMASTFGATATTLIVGSLIPDGDTVLKLKDNATYISHHR
    Newman          MDTATHIAIGVGLTALATQDPAMASTFGATATTLIVGSLIPDGDTVLKLKDNATYISHHR
    USA300_FPR3757  MDTATHIAIGVGLTALATQDPAMASTFGATATTLIVGSLIPDGDTVLKLKDNATYISHHR
                    ************************************************************

    COL             GITHSIPFTILWPILITFLIFTFFSGTNPFHVWMWAQLAVFLHVFVDIFNSYGTQALRPI
    N315            GITHSIPFTILWPILITFLIFTFFSGTNPFHVWMWAQLAVFLHVFVDIFNSYGTQALRPI
    NCTC8325        GITHSIPFTILWPILITFLIFTFFSGTNPFHVWMWAQLAVFLHVFVDIFNSYGTQALRPI
    Newman          GITHSIPFTILWPILITFLIFTFFSGTNPFHVWMWAQLAVFLHVFVDIFNSYGTQALRPI
    USA300_FPR3757  GITHSIPFTILWPILITFLIFTFFSGTNPFHVWMWAQLAVFLHVFVDIFNSYGTQALRPI
                    ************************************************************

    COL             TNKWIQLSVINTFDPIIFTVLCIGIVLWVIGLHPFAVFFPIIALLIIYYMIRFKMRAVIK
    N315            TNKWIQLSVINTFDPIIFTVLCIGIVLWVIGLHPFAVFFPIIALLIIYYMIRFKMRAVIK
    NCTC8325        TNKWIQLSVINTFDPIIFTVLCIGIVLWVIGLHPFAVFFPIIALLIIYYMIRFKMRAVIK
    Newman          TNKWIQLSVINTFDPIIFTVLCIGIVLWVIGLHPFAVFFPIIALLIIYYMIRFKMRAVIK
    USA300_FPR3757  TNKWIQLSVINTFDPIIFTVLCIGIVLWVIGLHPFAVFFPIIALLIIYYMIRFKMRAVIK
                    ************************************************************

    COL             QQALKAIQQEHHPVKVFVAPTIKFMEWRVAIQTDAHDYVGKAYGRNVVFSDKVERQTLST
    N315            QQALKAIQQEHHPVKVFVAPTIKFMEWRVAIQTDAHDYVGKAYGRNVVFSDKVERQTLST
    NCTC8325        QQALKAIQQEHHPVKVFVAPTIKFMEWRVAIQTDAHDYVGKAYGRNVVFSDKVERQTLST
    Newman          QQALKAIQQEHHPVKVFVAPTIKFMEWRVAIQTDAHDYVGKAYGRNVVFSDKVERQTLST
    USA300_FPR3757  QQALKAIQQEHHPVKVFVAPTIKFMEWRVAIQTDAHDYVGKAYGRNVVFSDKVERQTLST
                    ************************************************************

    COL             DSILWKVKGNKDIRTFLNFSSIYRWQTTTLADGSTEIRLIDLRYLKNDHYSFVAIAHVTN
    N315            DSILWKVKGNKDIRTFLNFSSIYRWQTTTLADGSTEIRLIDLRYLKNDHYSFVAIAHVTN
    NCTC8325        DSILWKVKGNKDIRTFLNFSSIYRWQTTTLADGSTEIRLIDLRYLKNDHYSFVAIAHVTN
    Newman          DSILWKVKGNKDIRTFLNFSSIYRWQTTTLADGSTEIRLIDLRYLKNDHYSFVAIAHVTN
    USA300_FPR3757  DSILWKVKGNKDIRTFLNFSSIYRWQTTTLADGSTEIRLIDLRYLKNDHYSFVAIAHVTN
                    ************************************************************

    COL             DNVIDHSYIGWVFTEDKLQRKLYAK
    N315            DNVIDHSYIGWVFTEDKLQRKLYAK
    NCTC8325        DNVIDHSYIGWVFTEDKLQRKLYAK
    Newman          DNVIDHSYIGWVFTEDKLQRKLYAK
    USA300_FPR3757  DNVIDHSYIGWVFTEDKLQRKLYAK
                    *************************