From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004853000
  • symbol?:
  • description?: Teichoic acid translocation permease protein TagG

      descriptions from strain specific annotations:

    • Teichoic acid translocation permease protein TagG
    • teichoic acid ABC superfamily ATP binding cassette transporter, membrane protein
    • teichoic acid ABC transporter ATP-binding/membrane protein
    • teichoic acid transport protein TagG
  • strand?: -
  • coordinates?: 5059350..5060416
  • synteny block?: BlockID0037830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1826 (tagG)
    08BA02176:
    C248_1942
    11819-97:
    MS7_1905
    71193:
    ST398NM01_1963
    ECT-R 2:
    ECTR2_1741
    ED133:
    SAOV_1897
    ED98:
    SAAV_1920
    HO 5096 0412:
    SAEMRSA15_17770
    JH1:
    SaurJH1_1958
    JH9:
    SaurJH9_1924
    JKD6008:
    SAA6008_01827
    JKD6159:
    SAA6159_01801
    LGA251:
    SARLGA251_17520
    M013:
    M013TW_1906
    MRSA252:
    SAR1960
    MSHR1132:
    SAMSHR1132_17150
    MSSA476:
    SAS1792
    Mu3:
    SAHV_1855
    Mu50:
    SAV1870
    MW2:
    MW1810
    RF122:
    SAB1803c
    ST398:
    SAPIG1963
    T0131:
    SAT0131_01993
    TCH60:
    HMPREF0772_11274 (tagG)
    TW20:
    SATW20_18640
    USA300_TCH1516:
    USA300HOU_1865
    VC40:
    SAVC_08605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLDNIILYFKNLPHTKRYVTERLKQSWKSFLIVLAACLILIIASETLFSFSHLTDVKEVR
    N315            MLDNIILYFKNLPHTKRYVTERLKQSWKSFLIVLAACLILIIASETLFSFSHLTDVKEVR
    NCTC8325        MLDNIILYFKNLPHTKRYVTERLKQSWKSFLIVLAACLILIIASETLFSFSHLTDVKEVR
    Newman          MLDNIILYFKNLPHTKRYVTERLKQSWKSFLIVLAACLILIIASETLFSFSHLTDVKEVR
    USA300_FPR3757  MLDNIILYFKNLPHTKRYVTERLKQSWKSFLIVLAACLILIIASETLFSFSHLTDVKEVR
                    ************************************************************

    COL             WLFRIIVLIVFAVVMFTIYISYHHYMNDFLVTKLFNISAATPVVIMSILSFIMLVILTMI
    N315            WLFRIIALIVFAVLMFTIYISYHHYMNDFLVTKLFNISAATPVVIMSILSFIMLVILTMI
    NCTC8325        WLFRIIVLIVFAVVMFTIYISYHHYMNDFLVTKLFNISAATPVVIMSILSFIMLVILTMI
    Newman          WLFRIIVLIVFAVVMFTIYISYHHYMNDFLVTKLFNISAATPVVIMSILSFIMLVILTMI
    USA300_FPR3757  WLFRIIVLIVFAVVMFTIYISYHHYMNDFLVTKLFNISAATPVVIMSILSFIMLVILTMI
                    ******.******:**********************************************

    COL             SALVKPVNFETSYIALFYFIVMATIFVGLISVTFGLIRLLTEKINIIFYGVCVLCFLLLP
    N315            SALVKPVNFETSYIALFYFIVMATIFVGLISVTFGLIRLLTEKINIIFYGVCVLCILLLP
    NCTC8325        SALVKPVNFETSYIALFYFIVMATIFVGLISVTFGLIRLLTEKINIIFYGVCVLCFLLLP
    Newman          SALVKPVNFETSYIALFYFIVMATIFVGLISVTFGLIRLLTEKINIIFYGVCVLCFLLLP
    USA300_FPR3757  SALVKPVNFETSYIALFYFIVMATIFVGLISVTFGLIRLLTEKINIIFYGVCVLCFLLLP
                    *******************************************************:****

    COL             IIFIPNPNHVFINHILMLNPMYYIVNGIAQSIIFGISSMENIPYHFYFILFLCLIAAVNF
    N315            IIFIPNPNHVFINHILMLNPMYYIVNGIAQSIIFGISSMENIPYHFYFILFLCLIAAVNF
    NCTC8325        IIFIPNPNHVFINHILMLNPMYYIVNGIAQSIIFGISSMENIPYHFYFILFLCLIAAVNF
    Newman          IIFIPNPNHVFINHILMLNPMYYIVNGIAQSIIFGISSMENIPYHFYFILFLCLIAAVNF
    USA300_FPR3757  IIFIPNPNHVFINHILMLNPMYYIVNGIAQSIIFGISSMENIPYHFYFILFLCLIAAVNF
                    ************************************************************

    COL             VLARYTTHAIYNKTSKVTQTDNQQDVSNDSTDEADTSS
    N315            VLARYTTHAIYNKTSKVTQTDNQQDVSNDSTDEADTSS
    NCTC8325        VLARYTTHAIYNKTSKVTQTDNQQDVSNDSTDEADTSS
    Newman          VLARYTTHAIYNKTSKVTQTDNQQDVSNDSTDEADTSS
    USA300_FPR3757  VLARYTTHAIYNKTSKVTQTDNQQDVSNDSTDEADTSS
                    **************************************