From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004854000
  • symbol?:
  • description?: teichoic acid translocation ATP-binding protein

      descriptions from strain specific annotations:

    • teichoic acid translocation ATP-binding protein
    • sugar ABC transporter ATPase
    • ABC transporter ATP-binding protein
    • Teichoic acid export ATP-binding protein TagH
    • teichoic acid translocation ATP-binding protein tagH
    • membrane protein
    • ABC-type polysaccharide/polyol phosphate transport system ATPase component-like protein
    • putative ABC transporter ATP-binding protein
    • teichoic acid ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
  • strand?: -
  • coordinates?: 5060425..5061942
  • synteny block?: BlockID0037840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1827 (tagH)
    08BA02176:
    C248_1943
    11819-97:
    MS7_1906
    71193:
    ST398NM01_1964
    ECT-R 2:
    ECTR2_1742
    ED133:
    SAOV_1898
    ED98:
    SAAV_1921
    HO 5096 0412:
    SAEMRSA15_17780
    JH1:
    SaurJH1_1959
    JH9:
    SaurJH9_1925
    JKD6008:
    SAA6008_01828
    JKD6159:
    SAA6159_01802
    LGA251:
    SARLGA251_17530
    M013:
    M013TW_1907
    MRSA252:
    SAR1961
    MSHR1132:
    SAMSHR1132_17160
    MSSA476:
    SAS1793
    Mu3:
    SAHV_1856
    Mu50:
    SAV1871
    MW2:
    MW1811
    RF122:
    SAB1804c
    ST398:
    SAPIG1964
    T0131:
    SAT0131_01994 (secA)
    TCH60:
    HMPREF0772_11273
    TW20:
    SATW20_18650
    USA300_TCH1516:
    USA300HOU_1866
    VC40:
    SAVC_08610

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGSSIVLKLLKVTHYYRNKQNKKWYLPFGYDAEDIDLNNISLHIYQGEALGIIGEPESSK
    N315            MGSSIVLKLLKVTHYYRNKQNKKWYLPFGYDAEDIDLNNISLHIYQGEALGIIGEPESSK
    NCTC8325        MGSSIVLKLLKVTHYYRNKQNKKWYLPFGYDAEDIDLNNISLHIYQGEALGIIGEPESSK
    Newman          MGSSIVLKLLKVTHYYRNKQNKKWYLPFGYDAEDIDLNNISLHIYQGEALGIIGEPESSK
    USA300_FPR3757  MGSSIVLKLLKVTHYYRNKQNKKWYLPFGYDAEDIDLNNISLHIYQGEALGIIGEPESSK
                    ************************************************************

    COL             ALVGQLLAGAIKPDKGKVVCTEDLFYGYIEDQSLIHQTVEAYTAQLVQLFPYEINDHKAE
    N315            ALVGQLLAGAIKPDKGKVVCTEDLFYGYIEDQSLIHQTVEAYTAQLVQLFPYEINDHKAE
    NCTC8325        ALVGQLLAGAIKPDKGKVVCTEDLFYGYIEDQSLIHQTVEAYTAQLVQLFPYEINDHKAE
    Newman          ALVGQLLAGAIKPDKGKVVCTEDLFYGYIEDQSLIHQTVEAYTAQLVQLFPYEINDHKAE
    USA300_FPR3757  ALVGQLLAGAIKPDKGKVVCTEDLFYGYIEDQSLIHQTVEAYTAQLVQLFPYEINDHKAE
                    ************************************************************

    COL             QIIQYAHLGDYKTKPVNHISKAAYAQLLLSIARSSKSNIIILNHVIDYLTPQFMERAIEL
    N315            QIIQYAHLGDYKTKPVNHISKAAYAQLLLSIARSSKSNIIILNHVIDYLTPQFMERAIEL
    NCTC8325        QIIQYAHLGDYKTKPVNHISKAAYAQLLLSIARSSKSNIIILNHVIDYLTPQFMERAIEL
    Newman          QIIQYAHLGDYKTKPVNHISKAAYAQLLLSIARSSKSNIIILNHVIDYLTPQFMERAIEL
    USA300_FPR3757  QIIQYAHLGDYKTKPVNHISKAAYAQLLLSIARSSKSNIIILNHVIDYLTPQFMERAIEL
                    ************************************************************

    COL             TNDYIENNLTIVSIGDDIDKISQVSNYIAWFSHGQLRMEGSLKQVIPSFKEHERDRLSLN
    N315            TNDYIENNLTIVSIGDDIDKISQVSNYIAWFSHGQLRMEGSLKQVIPSFKEHERDRLSLN
    NCTC8325        TNDYIENNLTIVSIGDDIDKISQVSNYIAWFSHGQLRMEGSLKQVIPSFKEHERDRLSLN
    Newman          TNDYIENNLTIVSIGDDIDKISQVSNYIAWFSHGQLRMEGSLKQVIPSFKEHERDRLSLN
    USA300_FPR3757  TNDYIENNLTIVSIGDDIDKISQVSNYIAWFSHGQLRMEGSLKQVIPSFKEHERDRLSLN
                    ************************************************************

    COL             SKEEIENFDLDWKKNRTRIPEMTYNFKRVERYNHAKPPKFLVRFWTLASGTILGLALMML
    N315            SKEEIENFDLDWKKNRTRIPEMTYNFKRVERYNHAKPPKFLVRFWTLASGTILGLALMML
    NCTC8325        SKEEIENFDLDWKKNRTRIPEMTYNFKRVERYNHAKPPKFLVRFWTLASGTILGLALMML
    Newman          SKEEIENFDLDWKKNRTRIPEMTYNFKRVERYNHAKPPKFLVRFWTLASGTILGLALMML
    USA300_FPR3757  SKEEIENFDLDWKKNRTRIPEMTYNFKRVERYNHAKPPKFLVRFWTLASGTILGLALMML
                    ************************************************************

    COL             LIFNNIGIISITDFTNRATMQNENKDPYGEKLAYGIAFNGSVDMQGDKQVTIPKYSVVTI
    N315            LIFNNIGIISITDFTNRATMQNENKDPYGEKLAYGIAFNGSVDMQGDKQVTIPKYSVVTI
    NCTC8325        LIFNNIGIISITDFTNRATMQNENKDPYGEKLAYGIAFNGSVDMQGDKQVTIPKYSVVTI
    Newman          LIFNNIGIISITDFTNRATMQNENKDPYGEKLAYGIAFNGSVDMQGDKQVTIPKYSVVTI
    USA300_FPR3757  LIFNNIGIISITDFTNRATMQNENKDPYGEKLAYGIAFNGSVDMQGDKQVTIPKYSVVTI
                    ************************************************************

    COL             TGENSKNYRVTADNKTYYVSKDKLEYFNPAGLYQTHSFKKLAPYMKSNYSNYYAYFNSQL
    N315            TGENSKNYRVTADNKTYYVSKDKLEYFNPAGLYQTHSFKKLAPYMKSNYSNYYAYFNSQL
    NCTC8325        TGENSKNYRVTADNKTYYVSKDKLEYFNPAGLYQTHSFKKLAPYMKSNYSNYYAYFNSQL
    Newman          TGENSKNYRVTADNKTYYVSKDKLEYFNPAGLYQTHSFKKLAPYMKSNYSNYYAYFNSQL
    USA300_FPR3757  TGENSKNYRVTADNKTYYVSKDKLEYFNPAGLYQTHSFKKLAPYMKSNYSNYYAYFNSQL
                    ************************************************************

    COL             HKKHSSVIKTLVPDDDNRFVASVTQQPIQLLFNDNNQLYGFVYPIVDKKELKDKFNINNN
    N315            HKKHSSVIKTLVPDDDNRFVASVTQQPIQLLFNDNNQLYGFVYPIVDKKELKDKFNINNN
    NCTC8325        HKKHSSVIKTLVPDDDNRFVASVTQQPIQLLFNDNNQLYGFVYPIVDKKELKDKFNINNN
    Newman          HKKHSSVIKTLVPDDDNRFVASVTQQPIQLLFNDNNQLYGFVYPIVDKKELKDKFNINNN
    USA300_FPR3757  HKKHSSVIKTLVPDDDNRFVASVTQQPIQLLFNDNNQLYGFVYPIVDKKELKDKFNINNN
                    ************************************************************

    COL             IWITKVGNGYCIANLKEDKWIYIEL
    N315            IWITKVGNGYCIANLKEDKWIYIEL
    NCTC8325        IWITKVGNGYCIANLKEDKWIYIEL
    Newman          IWITKVGNGYCIANLKEDKWIYIEL
    USA300_FPR3757  IWITKVGNGYCIANLKEDKWIYIEL
                    *************************