From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004896000
  • symbol?: ptpA
  • description?: protein-tyrosine-phosphatase

      descriptions from strain specific annotations:

    • protein-tyrosine-phosphatase
    • phosphotyrosine protein phosphatase
    • Low molecular weight protein tyrosine phosphatase
    • low molecular weight phosphotyrosine protein phosphatase family protein
    • low molecular weight protein-tyrosine-phosphatase ptpA
    • low molecular weight protein-tyrosine-phosphatase yfkj (lmptp)
    • low molecular weight phosphotyrosine proteinphosphatase
  • strand?: +
  • coordinates?: 5092867..5093331
  • synteny block?: BlockID0038020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1837
    08BA02176:
    C248_1953
    11819-97:
    MS7_1916 (ptpA)
    71193:
    ST398NM01_1974
    ECT-R 2:
    ECTR2_1752
    ED133:
    SAOV_1979
    ED98:
    SAAV_1946
    HO 5096 0412:
    SAEMRSA15_17880
    JH1:
    SaurJH1_1969
    JH9:
    SaurJH9_1935
    JKD6008:
    SAA6008_01901
    JKD6159:
    SAA6159_01812
    LGA251:
    SARLGA251_17630
    M013:
    M013TW_1917
    MRSA252:
    SAR1971
    MSHR1132:
    SAMSHR1132_17260
    MSSA476:
    SAS1803
    Mu3:
    SAHV_1866
    Mu50:
    SAV1881
    MW2:
    MW1821
    RF122:
    SAB1813
    ST398:
    SAPIG1974
    T0131:
    SAT0131_02005
    TCH60:
    HMPREF0772_11263 (ptpA)
    TW20:
    SATW20_18750
    USA300_TCH1516:
    USA300HOU_1877
    VC40:
    SAVC_08660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNK
    N315            MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNK
    NCTC8325        MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNK
    Newman          MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNK
    USA300_FPR3757  MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNK
                    ************************************************************

    COL             HNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPD
    N315            HNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPD
    NCTC8325        HNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPD
    Newman          HNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPD
    USA300_FPR3757  HNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPD
                    ************************************************************

    COL             PYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKEG
    N315            PYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKEG
    NCTC8325        PYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKEG
    Newman          PYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKEG
    USA300_FPR3757  PYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKEG
                    **********************************