From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004902000
  • symbol?: vraU
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5097615..5098001
  • synteny block?: BlockID0038080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1843
    08BA02176:
    C248_1959
    11819-97:
    MS7_1922
    71193:
    ST398NM01_1980
    ECT-R 2:
    ECTR2_1758
    ED133:
    SAOV_1985
    ED98:
    SAAV_1952
    HO 5096 0412:
    SAEMRSA15_17940
    JH1:
    SaurJH1_1975
    JH9:
    SaurJH9_1941
    JKD6008:
    SAA6008_01907
    JKD6159:
    SAA6159_01818
    LGA251:
    SARLGA251_17690
    M013:
    M013TW_1923
    MRSA252:
    SAR1977
    MSHR1132:
    SAMSHR1132_17320
    MSSA476:
    SAS1809
    Mu3:
    SAHV_1872
    Mu50:
    SAV1887
    MW2:
    MW1827
    RF122:
    SAB1819c
    ST398:
    SAPIG1980
    T0131:
    SAT0131_02011
    TCH60:
    HMPREF0772_11257
    TW20:
    SATW20_18810
    USA300_TCH1516:
    USA300HOU_1883
    VC40:
    SAVC_08690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYVERYIEQFLRATVRNNIKHYLLMLDEKMKNLDDYMRYLITKKEQLSKLIDSLMLTLE
    N315            MNYVERYIEQFLRATVRNNIKHYLLMLDEKMKNLDDYMRYLITKKEQLSKLIDSLMLTLE
    NCTC8325        MNYVERYIEQFLRATVRNNIKHYLLMLDEKMKNLDDYMRYLITKKEQLSKLIDSLMLTLE
    Newman          MNYVERYIEQFLRATVRNNIKHYLLMLDEKMKNLDDYMRYLITKKEQLSKLIDSLMLTLE
    USA300_FPR3757  MNYVERYIEQFLRATVRNNIKHYLLMLDEKMKNLDDYMRYLITKKEQLSKLIDSLMLTLE
                    ************************************************************

    COL             NKYIDIAEAFQIQCAREINNQEIENIKSELNKVEAYYAQIETQIQQTSTEKIATEKTSYL
    N315            NKYIDIAEAFQIQCAREINNQEIENIKSELNKVEAYYAQIETQIQQTSTEKIATEKTSYL
    NCTC8325        NKYIDIAEAFQIQCAREINNQEIENIKSELNKVEAYYAQIETQIQQTSTEKIATEKTSYL
    Newman          NKYIDIAEAFQIQCAREINNQEIENIKSELNKVEAYYAQIETQIQQTSTEKIATEKTSYL
    USA300_FPR3757  NKYIDIAEAFQIQCAREINNQEIENIKSELNKVEAYYAQIETQIQQTSTEKIATEKTSYL
                    ************************************************************

    COL             INYMNAVA
    N315            INYMNAVA
    NCTC8325        INYMNAVA
    Newman          INYMNAVA
    USA300_FPR3757  INYMNAVA
                    ********