From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004911000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5101507..5102117
  • synteny block?: BlockID0038170
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1846
    08BA02176:
    C248_1962
    11819-97:
    MS7_1925
    71193:
    ST398NM01_1983
    ECT-R 2:
    ECTR2_1761
    ED133:
    SAOV_1989
    ED98:
    SAAV_1955
    HO 5096 0412:
    SAEMRSA15_17970
    JH1:
    SaurJH1_1978
    JH9:
    SaurJH9_1944
    JKD6008:
    SAA6008_01910
    JKD6159:
    SAA6159_01821
    LGA251:
    SARLGA251_17720
    M013:
    M013TW_1926
    MRSA252:
    SAR1981
    MSHR1132:
    MSSA476:
    SAS1812
    Mu3:
    SAHV_1875
    Mu50:
    SAV1890
    MW2:
    MW1831
    RF122:
    SAB1822c
    ST398:
    SAPIG1983
    T0131:
    SAT0131_02015
    TCH60:
    HMPREF0772_11253
    TW20:
    SATW20_18840
    USA300_TCH1516:
    USA300HOU_1887
    VC40:
    SAVC_08710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------MKPTKVILKDASYLHSKTSITFILKDVVIEEDNKIYYFDTSATFEDQ
    N315            MQHEKMNDERNLTMKPTKVILRDASYLHSKTSITFILKDVVIEEDNKIYYFDTSATFEDQ
    NCTC8325        -------------MKPTKVILKDASYLHSKTSITFILKDVVIEEDNKIYYFDTSATFEDQ
    Newman          MQHEKMNDERNLTMKPTKVILKDASYLHSKTSITFILKDVVIEEDNKIYYFDTSATFEDQ
    USA300_FPR3757  -------------MKPTKVILKDASYLHSKTSITFILKDVVIEEDNKIYYFDTSATFEDQ
                                 ********:**************************************

    COL             EVKFEFALFDSDMDNLKHMDCDNPVTEIYFIEPDLHFTIIDFNQELLCIYIDFDSGLRHS
    N315            EVKFEFALFDSDMDNLKHMDYDNPVTEIYFIEPDLHFTIIDFNQELLCIYIDFDSGLRHS
    NCTC8325        EVKFEFALFDSDMDNLKHMDCDNPVTEIYFIEPDLHFTIIDFNQELLCIYIDFDSGLRHS
    Newman          EVKFEFALFDSDMDNLKHMDCDNPVTEIYFIEPDLHFTIIDFNQELLCIYIDFDSGLRHS
    USA300_FPR3757  EVKFEFALFDSDMDNLKHMDCDNPVTEIYFIEPDLHFTIIDFNQELLCIYIDFDSGLRHS
                    ******************** ***************************************

    COL             NMATESGISLRINVAKSDFTKFINELASLH
    N315            NMATESGISLRINIAKSDFTKFINELASLY
    NCTC8325        NMATESGISLRINVAKSDFTKFINELASLH
    Newman          NMATESGISLRINVAKSDFTKFINELASLH
    USA300_FPR3757  NMATESGISLRINVAKSDFTKFINELASLH
                    *************:***************: