From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004914000
  • symbol?: murT
  • description?: UDP-N-acetylmuramyl tripeptide synthetase-like

      descriptions from strain specific annotations:

    • UDP-N-acetylmuramyl tripeptide synthetase-like
    • Mur ligase family protein
    • UDP-N-acetylmuramyl tripeptide synthase
    • UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
    • mur ligase middle domain protein
    • murein peptide ligase
    • putative amino acid ligase
  • strand?: -
  • coordinates?: 5103082..5104416
  • synteny block?: BlockID0038200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1848
    08BA02176:
    C248_1965
    11819-97:
    MS7_1927
    71193:
    ST398NM01_1985
    ECT-R 2:
    ECTR2_1763
    ED133:
    SAOV_1991
    ED98:
    SAAV_1957
    HO 5096 0412:
    SAEMRSA15_17990
    JH1:
    SaurJH1_1980
    JH9:
    SaurJH9_1946
    JKD6008:
    SAA6008_01912 (murE2)
    JKD6159:
    SAA6159_01823 (murE2)
    LGA251:
    SARLGA251_17740
    M013:
    M013TW_1928
    MRSA252:
    SAR1983
    MSHR1132:
    SAMSHR1132_17360
    MSSA476:
    SAS1814
    Mu3:
    SAHV_1877
    Mu50:
    SAV1892
    MW2:
    MW1833
    RF122:
    SAB1824c
    ST398:
    SAPIG1985
    T0131:
    SAT0131_02017
    TCH60:
    HMPREF0772_11251 (murE)
    TW20:
    SATW20_18860
    USA300_TCH1516:
    USA300HOU_1890 (murE2)
    VC40:
    SAVC_08720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRQWTAIHLAKLARKASRAVGKRGTDLPGQIARKVDTDILRKLAEQVDDIVFISGTNGKT
    N315            MRQWTAIHLAKLARKASRAVGKRGTDLPGQIARKVDTDVLRKLAEQVDDIVFISGTNGKT
    NCTC8325        MRQWTAIHLAKLARKASRAVGKRGTDLPGQIARKVDTDILRKLAEQVDDIVFISGTNGKT
    Newman          MRQWTAIHLAKLARKASRAVGKRGTDLPGQIARKVDTDILRKLAEQVDDIVFISGTNGKT
    USA300_FPR3757  MRQWTAIHLAKLARKASRAVGKRGTDLPGQIARKVDTDILRKLAEQVDDIVFISGTNGKT
                    **************************************:*********************

    COL             TTSNLIGHTLKANNIQIIHNNEGANMAAGITSAFIMQSTPKTKIAVIEIDEGSIPRVLKE
    N315            TTSNLIGHTLKANNIQIIHNNEGANMAAGITSAFIMQSTPKTKIAVIEIDEGSIPRVLKE
    NCTC8325        TTSNLIGHTLKANNIQIIHNNEGANMAAGITSAFIMQSTPKTKIAVIEIDEGSIPRVLKE
    Newman          TTSNLIGHTLKANNIQIIHNNEGANMAAGITSAFIMQSTPKTKIAVIEIDEGSIPRVLKE
    USA300_FPR3757  TTSNLIGHTLKANNIQIIHNNEGANMAAGITSAFIMQSTPKTKIAVIEIDEGSIPRVLKE
                    ************************************************************

    COL             VTPSMMVFTNFFRDQMDRFGEIDIMVNNIAETISNKGIKLLLNADDPFVSRLKIASDTIV
    N315            VTPSMMVFTNFFRDQMDRFGEIDIMVNNIAETISNKGIKLLLNADDPFVSRLKIASDTIV
    NCTC8325        VTPSMMVFTNFFRDQMDRFGEIDIMVNNIAETISNKGIKLLLNADDPFVSRLKIASDTIV
    Newman          VTPSMMVFTNFFRDQMDRFGEIDIMVNNIAETISNKGIKLLLNADDPFVSRLKIASDTIV
    USA300_FPR3757  VTPSMMVFTNFFRDQMDRFGEIDIMVNNIAETISNKGIKLLLNADDPFVSRLKIASDTIV
                    ************************************************************

    COL             YYGMKAHAHEFEQSTMNESRYCPNCGRLLQYDYIHYNQIGHYHCQCGFKREQAKYEISSF
    N315            YYGMKAHAHEFEQSTMNESRYCPNCGRLLQYDYIHYNQIGHYHCQCGFKREQAKYEISSF
    NCTC8325        YYGMKAHAHEFEQSTMNESRYCPNCGRLLQYDYIHYNQIGHYHCQCGFKREQAKYEISSF
    Newman          YYGMKAHAHEFEQSTMNESRYCPNCGRLLQYDYIHYNQIGHYHCQCGFKREQAKYEISSF
    USA300_FPR3757  YYGMKAHAHEFEQSTMNESRYCPNCGRLLQYDYIHYNQIGHYHCQCGFKREQAKYEISSF
                    ************************************************************

    COL             DVAPFLYLNINDEKYDMKIAGDFNAYNALAAYTVLRELGLNEQTIKNGFETYTSDNGRMQ
    N315            DVAPFLYLNINDEKYDMKIAGDFNAYNALAAYTVLRELGLNEQTIKNGFETYTSDNGRMQ
    NCTC8325        DVAPFLYLNINDEKYDMKIAGDFNAYNALAAYTVLRELGLNEQTIKNGFETYTSDNGRMQ
    Newman          DVAPFLYLNINDEKYDMKIAGDFNAYNALAAYTVLRELGLNEQTIKNGFETYTSDNGRMQ
    USA300_FPR3757  DVAPFLYLNINDEKYDMKIAGDFNAYNALAAYTVLRELGLNEQTIKNGFETYTSDNGRMQ
                    ************************************************************

    COL             YFKKERKEAMINLAKNPAGMNASLSVGEQLEGEKVYVISLNDNAADGRDTSWIYDADFEK
    N315            YFKKERKEAMINLAKNPAGMNASLSVGEQLEGEKVYVISLNDNAADGRDTSWIYDADFEK
    NCTC8325        YFKKERKEAMINLAKNPAGMNASLSVGEQLEGEKVYVISLNDNAADGRDTSWIYDADFEK
    Newman          YFKKERKEAMINLAKNPAGMNASLSVGEQLEGEKVYVISLNDNAADGRDTSWIYDADFEK
    USA300_FPR3757  YFKKERKEAMINLAKNPAGMNASLSVGEQLEGEKVYVISLNDNAADGRDTSWIYDADFEK
                    ************************************************************

    COL             LSKQQIEAIIVTGTRAEELQLRLKLAEVEVPIIVERDIYKATAKTMDYKGFTVAIPNYTS
    N315            LSKQQIEAIIVTGTRAEELQLRLKLAEVEVPIIVERDIYKATAKTMDYKGFTVAIPNYTS
    NCTC8325        LSKQQIEAIIVTGTRAEELQLRLKLAEVEVPIIVERDIYKATAKTMDYKGFTVAIPNYTS
    Newman          LSKQQIEAIIVTGTRAEELQLRLKLAEVEVPIIVERDIYKATAKTMDYKGFTVAIPNYTS
    USA300_FPR3757  LSKQQIEAIIVTGTRAEELQLRLKLAEVEVPIIVERDIYKATAKTMDYKGFTVAIPNYTS
                    ************************************************************

    COL             LAPMLEQLNRSFEGGQS
    N315            LAPMLEQLNRSFEGGQS
    NCTC8325        LAPMLEQLNRSFEGGQS
    Newman          LAPMLEQLNRSFEGGQS
    USA300_FPR3757  LAPMLEQLNRSFEGGQS
                    *****************