From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004915000
  • symbol?: ftnA
  • description?: ferritin

      descriptions from strain specific annotations:

    • ferritin
    • ferritins family protein
    • Ferritin, Dps family protein
    • ferritin Dps family protein
    • Ferritin-like protein 2
    • ferritin-like domain protein
    • ferroxidase
  • strand?: +
  • coordinates?: 5104711..5105211
  • synteny block?: BlockID0038210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1849
    08BA02176:
    C248_1966
    11819-97:
    MS7_1928 (ftnA)
    71193:
    ST398NM01_1986
    ECT-R 2:
    ECTR2_1764
    ED133:
    SAOV_1992 (ftn)
    ED98:
    SAAV_1958
    HO 5096 0412:
    SAEMRSA15_18000
    JH1:
    SaurJH1_1981
    JH9:
    SaurJH9_1947
    JKD6008:
    SAA6008_01913 (ftn)
    JKD6159:
    SAA6159_01824 (ftn)
    LGA251:
    SARLGA251_17750
    M013:
    M013TW_1929
    MRSA252:
    SAR1984
    MSHR1132:
    SAMSHR1132_17370
    MSSA476:
    SAS1815
    Mu3:
    SAHV_1878
    Mu50:
    SAV1893
    MW2:
    MW1834
    RF122:
    SAB1825 (ftn)
    ST398:
    SAPIG1986
    T0131:
    SAT0131_02018
    TCH60:
    HMPREF0772_11250 (ftnA)
    TW20:
    SATW20_18870
    USA300_TCH1516:
    USA300HOU_1891
    VC40:
    SAVC_08725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSKNLLEALNDQMNHEYFAAHAYMAMAAYCDKESYEGFANFFIQQAKEERFHGQKIYNY
    N315            MLSKNLLEALNDQMNHEYFAAHAYMAMAAYCDKESYEGFANFFIQQAKEERFHGQKIYNY
    NCTC8325        MLSKNLLEALNDQMNHEYFAAHAYMAMAAYCDKESYEGFANFFIQQAKEERFHGQKIYNY
    Newman          MLSKNLLEALNDQMNHEYFAAHAYMAMAAYCDKESYEGFANFFIQQAKEERFHGQKIYNY
    USA300_FPR3757  MLSKNLLEALNDQMNHEYFAAHAYMAMAAYCDKESYEGFANFFIQQAKEERFHGQKIYNY
                    ************************************************************

    COL             INDRGAHAEFRAVSAPKIDFSSILETFKDSLSQEQEVTRRFYNLSEIARQDKDYATISFL
    N315            INDRGAHAEFRAVSAPKIDFSSILETFKDSLSQEQEVTRRFYNLSEIARQDKDYATISFL
    NCTC8325        INDRGAHAEFRAVSAPKIDFSSILETFKDSLSQEQEVTRRFYNLSEIARQDKDYATISFL
    Newman          INDRGAHAEFRAVSAPKIDFSSILETFKDSLSQEQEVTRRFYNLSEIARQDKDYATISFL
    USA300_FPR3757  INDRGAHAEFRAVSAPKIDFSSILETFKDSLSQEQEVTRRFYNLSEIARQDKDYATISFL
                    ************************************************************

    COL             NWFLDEQVEEESMFETHINYLTRIGDDSNALYLYEKELGARTFDEE
    N315            NWFLDEQVEEESMFETHINYLTRIGDDSNALYLYEKELGARTFDEE
    NCTC8325        NWFLDEQVEEESMFETHINYLTRIGDDSNALYLYEKELGARTFDEE
    Newman          NWFLDEQVEEESMFETHINYLTRIGDDSNALYLYEKELGARTFDEE
    USA300_FPR3757  NWFLDEQVEEESMFETHINYLTRIGDDSNALYLYEKELGARTFDEE
                    **********************************************