From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004919000
  • symbol?: dinP
  • description?: DNA polymerase IV

      descriptions from strain specific annotations:

    • DNA polymerase IV
    • impB/mucB/samB family protein
    • DNA-damage-inducible protein P
    • DNA-directed DNA polymerase IV
  • strand?: -
  • coordinates?: 5107923..5108964
  • synteny block?: BlockID0038250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1955 (dinP)
    N315:
    NCTC8325:
    Newman:
    NWMN_1833 (dinP)
    USA300_FPR3757:
    04-02981:
    SA2981_1851
    08BA02176:
    C248_1969
    11819-97:
    MS7_1930
    71193:
    ST398NM01_1988
    ECT-R 2:
    ECTR2_1766
    ED133:
    SAOV_1994
    ED98:
    SAAV_1961 (dinP)
    HO 5096 0412:
    SAEMRSA15_18020
    JH1:
    SaurJH1_1983
    JH9:
    SaurJH9_1949
    JKD6008:
    SAA6008_01915 (dinP)
    JKD6159:
    SAA6159_01826 (dinP)
    LGA251:
    SARLGA251_17770
    M013:
    M013TW_1931
    MRSA252:
    SAR1986
    MSHR1132:
    SAMSHR1132_17400
    MSSA476:
    SAS1817
    Mu3:
    SAHV_1880
    Mu50:
    SAV1895
    MW2:
    MW1836
    RF122:
    SAB1827c
    ST398:
    SAPIG1988 (dinB)
    T0131:
    SAT0131_02020
    TCH60:
    HMPREF0772_11248 (dinB)
    TW20:
    SATW20_18890
    USA300_TCH1516:
    USA300HOU_1894
    VC40:
    SAVC_08735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTERRIIHIDMDYFFAQVEMRDNPKLKGKPVIVGGKASSRGVVSTASYEARKYGVHSAMP
    N315            MTERRIIHIDMDYFFAQVEMRDNPKLKGKPVIVGGKASSRGVVSTASYEARKYGVHSAMP
    NCTC8325        ----------MDYFFAQVEMRDNPKLKGKPVIVGGKASSRGVVSTASYEARKYGVHSAMP
    Newman          MTERRIIHIDMDYFFAQVEMRDNPKLKGKPVIVGGKASSRGVVSTASYEARKYGVHSAMP
    USA300_FPR3757  ----------MDYFFAQVEMRDNPKLKGKPVIVGGKASSRGVVSTASYEARKYGVHSAMP
                              **************************************************

    COL             MSQAHKLCPNGYFVTSNFGAYRETSAQIMSIFRSYTDKVEPMSLDEAYLDITELVRPDLP
    N315            MSQAHKLCPNGYFVTSNFGAYRETSAQIMSIFRSYTDKVEPMSLDEAYLDITELVRPDLP
    NCTC8325        MSQAHKLCPNGYFVTSNFGAYRETSAQIMSIFRSYTDKVEPMSLDEAYLDITELVRPDLP
    Newman          MSQAHKLCPNGYFVTSNFGAYRETSAQIMSIFRSYTDKVEPMSLDEAYLDITELVRPDLP
    USA300_FPR3757  MSQAHKLCPNGYFVTSNFGAYRETSAQIMSIFRSYTDKVEPMSLDEAYLDITELVRPDLP
                    ************************************************************

    COL             ASKIAQYIRKDILEQTHLTASAGVSYNKFLAKLASGMNKPDGMTVIDYQNVHDILMTLDI
    N315            ASKIAQYIRKDILEQTHLTASAGVSYNKFLAKLASGMNKPDGLTVIDYQNVHDILMTLDI
    NCTC8325        ASKIAQYIRKDILEQTHLTASAGVSYNKFLAKLASGMNKPDGMTVIDYQNVHDILMTLDI
    Newman          ASKIAQYIRKDILEQTHLTASAGVSYNKFLAKLASGMNKPDGMTVIDYQNVHDILMTLDI
    USA300_FPR3757  ASKIAQYIRKDILEQTHLTASAGVSYNKFLAKLASGMNKPDGMTVIDYQNVHDILMTLDI
                    ******************************************:*****************

    COL             GDFPGVGKASKKVMHDNGIFNGRDLYEKTEFELIRLFGKRGRGLYNKARGIDHSEVKSSR
    N315            GDFPGVGKASKKVMHDNGIFNGRDLYEKTEFELIRLFGKRGRGLYNKARGIDHSEVKSSR
    NCTC8325        GDFPGVGKASKKVMHDNGIFNGRDLYEKTEFELIRLFGKRGRGLYNKARGIDHSEVKSSR
    Newman          GDFPGVGKASKKVMHDNGIFNGRDLYEKTEFELIRLFGKRGRGLYNKARGIDHSEVKSSR
    USA300_FPR3757  GDFPGVGKASKKVMHDNGIFNGRDLYEKTEFELIRLFGKRGRGLYNKARGIDHSEVKSSR
                    ************************************************************

    COL             VRKSVGTERTFATDVNDDEEILRKVWELSGKTAERLNKLQKSAKTVTVKIKTYQFETLSK
    N315            VRKSVGTERTFATDVNDDEEILRKVWELSGKTAERLNKLQKSAKTVTVKIKTYQFETLSK
    NCTC8325        VRKSVGTERTFATDVNDDEEILRKVWELSGKTAERLNKLQKSAKTVTVKIKTYQFETLSK
    Newman          VRKSVGTERTFATDVNDDEEILRKVWELSGKTAERLNKLQKSAKTVTVKIKTYQFETLSK
    USA300_FPR3757  VRKSVGTERTFATDVNDDEEILRKVWELSGKTAERLNKLQKSAKTVTVKIKTYQFETLSK
                    ************************************************************

    COL             QMSLRDSVSSEEDIYNIAYLLYNDLKDPDVPIRLIGVTVGNLEQSTYKNMTIYDFI
    N315            QMSLRDSVSSEEDIYNIAYLLYNDLKDPDVPIRLIGVTVGNLEQSTYKNMTIYDFI
    NCTC8325        QMSLRDSVSSEEDIYNIAYLLYNDLKDPDVPIRLIGVTVGNLEQSTYKNMTIYDFI
    Newman          QMSLRDSVSSEEDIYNIAYLLYNDLKDPDVPIRLIGVTVGNLEQSTYKNMTIYDFI
    USA300_FPR3757  QMSLRDSVSSEEDIYNIAYLLYNDLKDPDVPIRLIGVTVGNLEQSTYKNMTIYDFI
                    ********************************************************