From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004921000
  • symbol?: rumA
  • description?: RNA methyltransferase

      descriptions from strain specific annotations:

    • RNA methyltransferase
    • RNA methyltransferase TrmA family protein
    • 23S rRNA (uracil-5-)-methyltransferase RumA
    • 23S rRNA m(5)U1939 methyltransferase
    • putative RNA methyltransferase
    • RNA methyltransferase, TrmA family
    • RNA methyltransferase-like protein
    • rRNA methyltransferase RumA
    • TrmA family RNA methyltransferase
    • Uncharacterized RNA methyltransferase
  • strand?: -
  • coordinates?: 5109944..5111305
  • synteny block?: BlockID0038270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1853
    08BA02176:
    C248_1971
    11819-97:
    MS7_1932 (rumA)
    71193:
    ST398NM01_1990
    ECT-R 2:
    ECTR2_1768 (rumA)
    ED133:
    SAOV_1996
    ED98:
    SAAV_1963 (rumA)
    HO 5096 0412:
    SAEMRSA15_18040
    JH1:
    SaurJH1_1985
    JH9:
    SaurJH9_1951
    JKD6008:
    SAA6008_01917
    JKD6159:
    SAA6159_01828
    LGA251:
    SARLGA251_17790
    M013:
    M013TW_1933
    MRSA252:
    SAR1988
    MSHR1132:
    SAMSHR1132_17420
    MSSA476:
    SAS1819
    Mu3:
    SAHV_1882
    Mu50:
    SAV1897
    MW2:
    MW1838
    RF122:
    SAB1829c
    ST398:
    SAPIG1990 (rumA)
    T0131:
    SAT0131_02022 (gap)
    TCH60:
    HMPREF0772_11246 (rumA)
    TW20:
    SATW20_18910
    USA300_TCH1516:
    USA300HOU_1896
    VC40:
    SAVC_08745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQAIAKNDIKTGTVVDLTHEGHGVVKIDRFPIFIPQALINEQIEYKIIKVKKNFAIGKLL
    N315            MQAIAKNDIKTGTVVDLTHEGHGVVKIDRFPIFIPQALINEQIEYKIIKVKKNFAIGKLL
    NCTC8325        MQAIAKNDIKTGTVVDLTHEGHGVVKIDRFPIFIPQALINEQIEYKIIKVKKNFAIGKLL
    Newman          MQAIAKNDIKTGTVVDLTHEGHGVVKIDRFPIFIPQALINEQIEYKIIKVKKNFAIGKLL
    USA300_FPR3757  MQAIAKNDIKTGTVVDLTHEGHGVVKIDRFPIFIPQALINEQIEYKIIKVKKNFAIGKLL
                    ************************************************************

    COL             NINTRSENRVAPPCIYYERCGGCQLQHLSYEAQLEMKKEQVINLFQRKAHFDNSKINDTV
    N315            NINTRSENRVAPPCIYYERCGGCQLQHLSYEAQLEMKKEQVINLFQRKAHFDNSKINDTV
    NCTC8325        NINTRSENRVAPPCIYYERCGGCQLQHLSYEAQLEMKKEQVINLFQRKAHFDNSKINDTV
    Newman          NINTRSENRVAPPCIYYERCGGCQLQHLSYEAQLEMKKEQVINLFQRKAHFDNSKINDTV
    USA300_FPR3757  NINTRSENRVAPPCIYYERCGGCQLQHLSYEAQLEMKKEQVINLFQRKAHFDNSKINDTV
                    ************************************************************

    COL             GMTDPWRYRNKSQIPVGKNEQNEVIMGFYRQRSHDIIDMESCLIQDSQHQEVMNEVKSIL
    N315            GMTDPWRYRNKSQIPVGKNEQNEVIMGFYRQRSHDIIDMESCLIQDSQHQEVMNEVKSIL
    NCTC8325        GMTDPWRYRNKSQIPVGKNEQNEVIMGFYRQRSHDIIDMESCLIQDSQHQEVMNEVKSIL
    Newman          GMTDPWRYRNKSQIPVGKNEQNEVIMGFYRQRSHDIIDMESCLIQDSQHQEVMNEVKSIL
    USA300_FPR3757  GMTDPWRYRNKSQIPVGKNEQNEVIMGFYRQRSHDIIDMESCLIQDSQHQEVMNEVKSIL
                    ************************************************************

    COL             KDLNVSIYQEQLKKGLMRHLVVRTGYHTDEMMIIFVTNGKKWPQKNAVVEKILDAFPNVT
    N315            KDLNVSIYQEQLKKGLMRHLVVRTGYHTDEMMIIFVTNGKKWPQKNAVVEKILDAFPNVT
    NCTC8325        KDLNVSIYQEQLKKGLMRHLVVRTGYHTDEMMIIFVTNGKKWPQKNAVVEKILDAFPNVT
    Newman          KDLNVSIYQEQLKKGLMRHLVVRTGYHTDEMMIIFVTNGKKWPQKNAVVEKILDAFPNVT
    USA300_FPR3757  KDLNVSIYQEQLKKGLMRHLVVRTGYHTDEMMIIFVTNGKKWPQKNAVVEKILDAFPNVT
                    ************************************************************

    COL             SIKQNINDSHSNVIMGRQSITLYGKDTIIDQLTDSTFKISDQSFYQINSEQTEKLYNKAI
    N315            SIKQNINDSHSNVIMGRQSITLYGKDTIIDQLTDSTFKISDQSFYQINSEQTEKLYNKAI
    NCTC8325        SIKQNINDSHSNVIMGRQSITLYGKDTIIDQLTDSTFKISDQSFYQINSEQTEKLYNKAI
    Newman          SIKQNINDSHSNVIMGRQSITLYGKDTIIDQLTDSTFKISDQSFYQINSEQTEKLYNKAI
    USA300_FPR3757  SIKQNINDSHSNVIMGRQSITLYGKDTIIDQLTDSTFKISDQSFYQINSEQTEKLYNKAI
                    ************************************************************

    COL             EYAQLTGNEVVLDTYCGIGTIGLYMAPLAKHVYGVEVVPSAIEDAQQNATINQCNNTTFV
    N315            EYAQLTGNEVVLDTYCGIGTIGLYMAPHAKHVYGVEVVPSSIEDAQQNATINQCNNTTFV
    NCTC8325        EYAQLTGNEVVLDTYCGIGTIGLYMAPLAKHVYGVEVVPSAIEDAQQNATINQCNNTTFV
    Newman          EYAQLTGNEVVLDTYCGIGTIGLYMAPLAKHVYGVEVVPSAIEDAQQNATINQCNNTTFV
    USA300_FPR3757  EYAQLTGNEVVLDTYCGIGTIGLYMAPLAKHVYGVEVVPSAIEDAQQNATINQCNNTTFV
                    *************************** ************:*******************

    COL             CGKAEEVILQWKAQGIKPDVVMVDPPRKGCDETFIQTLLTLEPKRIVYISCNPATQQRDA
    N315            CGKAEEVILQWKAQGIKPDVVMVDPPRKGCDETFIQTLLTLEPKRIVYISCNPATQQRDA
    NCTC8325        CGKAEEVILQWKAQGIKPDVVMVDPPRKGCDETFIQTLLTLEPKRIVYISCNPATQQRDA
    Newman          CGKAEEVILQWKAQGIKPDVVMVDPPRKGCDETFIQTLLTLEPKRIVYISCNPATQQRDA
    USA300_FPR3757  CGKAEEVILQWKAQGIKPDVVMVDPPRKGCDETFIQTLLTLEPKRIVYISCNPATQQRDA
                    ************************************************************

    COL             LLLAEKYQLEEVTPVDMFPQTTHVETVALFNLK
    N315            LLLAEKYQLEEVTPVDMFPQTTHVETVALFNLK
    NCTC8325        LLLAEKYQLEEVTPVDMFPQTTHVETVALFNLK
    Newman          LLLAEKYQLEEVTPVDMFPQTTHVETVALFNLK
    USA300_FPR3757  LLLAEKYQLEEVTPVDMFPQTTHVETVALFNLK
                    *********************************