From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004939000
  • symbol?:
  • description?: staphopain, cysteine proteinase

      descriptions from strain specific annotations:

    • staphopain, cysteine proteinase
    • cysteine protease precursor SspB
    • Staphopain A precursor
    • staphopain peptidase C47 family protein
    • staphopain A
    • staphopain thiol proteinase
    • C47 family staphopain protease
    • staphopain cysteine proteinase
    • cysteine protease SspB
    • staphopain A (Staphylopain A) (Staphylococcalcysteine proteinase A)
  • strand?: +
  • coordinates?: 5129546..5130712
  • synteny block?: BlockID0038440
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1970 (sspB2)
    N315:
    NCTC8325:
    Newman:
    NWMN_1847 (sspB)
    USA300_FPR3757:
    04-02981:
    SA2981_1866
    08BA02176:
    C248_1984
    11819-97:
    MS7_1944 (sspP)
    71193:
    ST398NM01_2003
    ECT-R 2:
    ECTR2_1781
    ED133:
    SAOV_2011
    ED98:
    SAAV_1975 (sspB2)
    HO 5096 0412:
    SAEMRSA15_18160
    JH1:
    SaurJH1_1998
    JH9:
    SaurJH9_1964
    JKD6008:
    SAA6008_01930 (sspB2)
    JKD6159:
    SAA6159_01840
    LGA251:
    SARLGA251_17940 (scpA)
    M013:
    M013TW_1946
    MRSA252:
    SAR2001
    MSHR1132:
    MSSA476:
    SAS1832
    Mu3:
    SAHV_1894
    Mu50:
    SAV1909
    MW2:
    MW1850
    RF122:
    SAB1845
    ST398:
    SAPIG2003
    T0131:
    SAT0131_02036
    TCH60:
    HMPREF0772_11233 (sspB)
    TW20:
    SATW20_19040 (scpA)
    USA300_TCH1516:
    USA300HOU_1910
    VC40:
    SAVC_08805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRNFPKLIALSLIFSLSVTPIANAESNSNIKAKDKKHVQVNVEDKSVPTDVRNLAQKDY
    N315            MKRNFPKLIALSLIFSLSVTPIANAESNSNIKAKDKKHVQVNVEDKSVPTDVRNLAQKDY
    NCTC8325        MKRNFPKLIALSLIFSLSVTPIANAESNSNIKAKDKKHVQVNVEDKSVPTDVRNLAQKDY
    Newman          MKRNFPKLIALSLIFSLSVTPIANAESNSNIKAKDKKHVQVNVEDKSVPTDVRNLAQKDY
    USA300_FPR3757  MKRNFPKLIALSLIFSLSVTPIANAESNSNIKAKDKKHVQVNVEDKSVPTDVRNLAQKDY
                    ************************************************************

    COL             LSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKITK
    N315            LSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKITK
    NCTC8325        LSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKITK
    Newman          LSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKITK
    USA300_FPR3757  LSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKITK
                    ************************************************************

    COL             YSSSSSKYTINVSPFLSKVLNQYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKL
    N315            YSSSSSKYTINVSPFLSKVLNQYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKL
    NCTC8325        YSSSSSKYTINVSPFLSKVLNQYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKL
    Newman          YSSSSSKYTINVSPFLSKVLNQYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKL
    USA300_FPR3757  YSSSSSKYTINVSPFLSKVLNQYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKL
                    ************************************************************

    COL             KKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYINKLENFKIRETQGNNGWCAG
    N315            KKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYINKLENFKIRETQGNNGWCAG
    NCTC8325        KKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYINKLENFKIRETQGNNGWCAG
    Newman          KKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYINKLENFKIRETQGNNGWCAG
    USA300_FPR3757  KKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYINKLENFKIRETQGNNGWCAG
                    ************************************************************

    COL             YTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNR
    N315            YTMSALLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNR
    NCTC8325        YTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNR
    Newman          YTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNR
    USA300_FPR3757  YTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNR
                    **** *******************************************************

    COL             MTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNSWDNG
    N315            MTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNPWDNG
    NCTC8325        MTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNPWDNG
    Newman          MTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNSWDNG
    USA300_FPR3757  MTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNPWDNG
                    *******************************************************.****

    COL             FMTQDAKNNVIPVSNGDHYRWYSSIYGY
    N315            FMTQDAKNNVIPVSNGDHYRWYSSIYGY
    NCTC8325        FMTQDAKNNVIPVSNGDHYRWYSSIYGY
    Newman          FMTQDAKNNVIPVSNGDHYRWYSSIYGY
    USA300_FPR3757  FMTQDAKNNVIPVSNGDHYRWYSSIYGY
                    ****************************