From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004940000
  • symbol?:
  • description?: staphostatin A

      descriptions from strain specific annotations:

    • staphostatin A
    • staphostatin A superfamily protein
    • Staphostatin like protein
  • strand?: +
  • coordinates?: 5130716..5131066
  • synteny block?: BlockID0038450
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1867
    08BA02176:
    C248_1985
    11819-97:
    71193:
    ST398NM01_2004
    ECT-R 2:
    ED133:
    SAOV_2012
    ED98:
    SAAV_1976
    HO 5096 0412:
    SAEMRSA15_18170
    JH1:
    SaurJH1_1999
    JH9:
    SaurJH9_1965
    JKD6008:
    JKD6159:
    SAA6159_01841 (sspA)
    LGA251:
    M013:
    MRSA252:
    SAR2002
    MSHR1132:
    MSSA476:
    SAS1833
    Mu3:
    SAHV_1895
    Mu50:
    SAV1910
    MW2:
    MW1851
    RF122:
    SAB1846
    ST398:
    SAPIG2004
    T0131:
    SAT0131_02037
    TCH60:
    HMPREF0772_11232
    TW20:
    USA300_TCH1516:
    USA300HOU_1911
    VC40:
    SAVC_08810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQIELFSIDKFKCNSEAKYYLNIIEGEWHPQDLNDSPLKFILSTSDDSDYICKYINTEH
    N315            MEQIELFSIDKFKCNSEAKYYLNIIEGEWHPQDLNDSPLKFILSTSDDSDYICKYINTEH
    NCTC8325        MEQIELFSIDKFKCNSEAKYYLNIIEGEWHPQDLNDSPLKFILSTSDDSDYICKYINTEH
    Newman          MEQIELFSIDKFKCNSEAKYYLNIIEGEWHPQDLNDSPLKFILSTSDDSDYICKYINTEH
                    ************************************************************

    COL             KQLTLYNKNNSSIVIEIFIPNDNKILLTIMNTEALGTSPRMTFIKHKS
    N315            KQLTLYNKNNSSIVIEIFIPNDNKILLTIMNTEALGTSPRMTFIKHKS
    NCTC8325        KQLTLYNKNNSSIVIEIFIPNDNKILLTIMNTEALGTSPRMTFIKHKS
    Newman          KQLTLYNKNNSSIVIEIFIPNDNKILLTIMNTEALGTSPRMTFIKHKS
                    ************************************************